BLASTX nr result
ID: Cornus23_contig00039079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00039079 (261 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003387500.1| PREDICTED: 40S ribosomal protein S13 [Amphim... 147 3e-33 gb|ELU17309.1| hypothetical protein CAPTEDRAFT_149191 [Capitella... 146 7e-33 gb|KKK20467.1| 40S ribosomal protein [Aspergillus ochraceoroseus... 145 9e-33 emb|CDS05396.1| Putative 40S ribosomal protein [Lichtheimia ramosa] 145 1e-32 emb|CDH52172.1| 40s ribosomal protein s13 [Lichtheimia corymbife... 145 1e-32 tpe|CBF71234.1| TPA: hypothetical protein similar to 40s ribosom... 145 1e-32 gb|KFA66560.1| hypothetical protein S40285_00746 [Stachybotrys c... 145 2e-32 gb|KFA46633.1| hypothetical protein S40293_08198 [Stachybotrys c... 145 2e-32 gb|KOF71261.1| hypothetical protein OCBIM_22001297mg [Octopus bi... 144 3e-32 ref|XP_001391379.1| 40S ribosomal protein S13 [Aspergillus niger... 144 3e-32 emb|CCQ18649.1| 40S ribosomal protein S13 [Sycon ciliatum] 144 3e-32 ref|XP_014172534.1| splicing factor u2af large subunit [Grosmann... 144 3e-32 ref|XP_002420858.1| 40S ribosomal protein S13 [Candida dublinien... 143 4e-32 ref|XP_002493888.1| 40S ribosomal protein S13 [Komagataella phaf... 143 4e-32 gb|KLU92798.1| 40S ribosomal protein S13 [Magnaporthiopsis poae ... 143 6e-32 ref|XP_009496067.1| 40S ribosomal protein S13 [Fonticula alba] g... 143 6e-32 gb|KNE61503.1| 40S ribosomal protein S13 [Allomyces macrogynus A... 142 8e-32 sp|P46298.1|RS13_PEA RecName: Full=40S ribosomal protein S13 gi|... 142 8e-32 ref|XP_006892104.1| PREDICTED: 40S ribosomal protein S13 [Elepha... 142 8e-32 gb|KDN63257.1| putative 40S ribosomal protein S13 [Colletotrichu... 142 8e-32 >ref|XP_003387500.1| PREDICTED: 40S ribosomal protein S13 [Amphimedon queenslandica] Length = 151 Score = 147 bits (371), Expect = 3e-33 Identities = 70/86 (81%), Positives = 79/86 (91%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQVK +TGN+ILRILKA LAPS+PEDLYHLIKKAV++RKH+EK RKDKD KF+LILVES Sbjct: 61 AQVKWITGNKILRILKAKALAPSLPEDLYHLIKKAVSIRKHMEKHRKDKDSKFRLILVES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYYKT SVLPPNW+YES +A Sbjct: 121 RIHRLARYYKTKSVLPPNWKYESSTA 146 >gb|ELU17309.1| hypothetical protein CAPTEDRAFT_149191 [Capitella teleta] Length = 151 Score = 146 bits (368), Expect = 7e-33 Identities = 69/86 (80%), Positives = 79/86 (91%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQV+ VTGN++LRILK+ GLAP IPEDLYHLIKKAV+MRKHLE+ RKDKD KF+LILVES Sbjct: 61 AQVRFVTGNKVLRILKSKGLAPEIPEDLYHLIKKAVSMRKHLERNRKDKDTKFRLILVES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYYKT+ VLPPNW+YES +A Sbjct: 121 RIHRLARYYKTSKVLPPNWKYESATA 146 >gb|KKK20467.1| 40S ribosomal protein [Aspergillus ochraceoroseus] gi|816352694|gb|KKK26799.1| 40S ribosomal protein [Aspergillus rambellii] Length = 151 Score = 145 bits (367), Expect = 9e-33 Identities = 68/86 (79%), Positives = 78/86 (90%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQVK+VTGN+ILRILK+NGLAP +PEDLYHLIKKAV +RKHLE+ RKDKD KF+LIL+ES Sbjct: 61 AQVKTVTGNKILRILKSNGLAPELPEDLYHLIKKAVAVRKHLERNRKDKDSKFRLILIES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRL+RYYKT VLPP WRYES +A Sbjct: 121 RIHRLSRYYKTVGVLPPTWRYESSTA 146 >emb|CDS05396.1| Putative 40S ribosomal protein [Lichtheimia ramosa] Length = 151 Score = 145 bits (366), Expect = 1e-32 Identities = 68/85 (80%), Positives = 79/85 (92%) Frame = -1 Query: 258 QVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVESR 79 QVK+VTGN+I+RILKANG+AP IPEDLYHLIKKAV+MRKHLE+ RKDKD K++LILVESR Sbjct: 62 QVKAVTGNKIVRILKANGMAPEIPEDLYHLIKKAVSMRKHLERNRKDKDTKYRLILVESR 121 Query: 78 IHRLARYYKTASVLPPNWRYESGSA 4 IHRLARYYKTA LPPNW++ES +A Sbjct: 122 IHRLARYYKTAGYLPPNWKFESATA 146 >emb|CDH52172.1| 40s ribosomal protein s13 [Lichtheimia corymbifera JMRC:FSU:9682] gi|661185616|emb|CDH52260.1| 40s ribosomal protein s13 [Lichtheimia corymbifera JMRC:FSU:9682] gi|671690718|emb|CDS05457.1| Putative 40S ribosomal protein S13 [Lichtheimia ramosa] Length = 151 Score = 145 bits (366), Expect = 1e-32 Identities = 68/85 (80%), Positives = 79/85 (92%) Frame = -1 Query: 258 QVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVESR 79 QVK+VTGN+I+RILKANG+AP IPEDLYHLIKKAV+MRKHLE+ RKDKD K++LILVESR Sbjct: 62 QVKAVTGNKIVRILKANGMAPEIPEDLYHLIKKAVSMRKHLERNRKDKDTKYRLILVESR 121 Query: 78 IHRLARYYKTASVLPPNWRYESGSA 4 IHRLARYYKTA LPPNW++ES +A Sbjct: 122 IHRLARYYKTAGYLPPNWKFESATA 146 >tpe|CBF71234.1| TPA: hypothetical protein similar to 40s ribosomal protein s13 (Broad) [Aspergillus nidulans FGSC A4] Length = 151 Score = 145 bits (366), Expect = 1e-32 Identities = 68/86 (79%), Positives = 78/86 (90%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQVK+VTGN+ILRILK+NGLAP IPEDLYHLIKKAV +RKHLE+ RKDKD KF+LIL+ES Sbjct: 61 AQVKTVTGNKILRILKSNGLAPEIPEDLYHLIKKAVAVRKHLERNRKDKDSKFRLILIES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRL+RYYKT VLPP W+YES +A Sbjct: 121 RIHRLSRYYKTVGVLPPTWKYESATA 146 >gb|KFA66560.1| hypothetical protein S40285_00746 [Stachybotrys chlorohalonata IBT 40285] Length = 151 Score = 145 bits (365), Expect = 2e-32 Identities = 70/86 (81%), Positives = 77/86 (89%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQVK VTGNRILRILK+NGLAP IPEDLY LIKKAV +RKHLE+ RKDKD KF+LIL+ES Sbjct: 61 AQVKVVTGNRILRILKSNGLAPDIPEDLYMLIKKAVAVRKHLERNRKDKDSKFRLILIES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYYKT VLPPNW+YES +A Sbjct: 121 RIHRLARYYKTVGVLPPNWKYESATA 146 >gb|KFA46633.1| hypothetical protein S40293_08198 [Stachybotrys chartarum IBT 40293] Length = 151 Score = 145 bits (365), Expect = 2e-32 Identities = 70/86 (81%), Positives = 77/86 (89%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQVK VTGNRILRILK+NGLAP IPEDLY LIKKAV +RKHLE+ RKDKD KF+LIL+ES Sbjct: 61 AQVKVVTGNRILRILKSNGLAPDIPEDLYMLIKKAVAVRKHLERNRKDKDSKFRLILIES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYYKT VLPPNW+YES +A Sbjct: 121 RIHRLARYYKTVGVLPPNWKYESATA 146 >gb|KOF71261.1| hypothetical protein OCBIM_22001297mg [Octopus bimaculoides] Length = 151 Score = 144 bits (363), Expect = 3e-32 Identities = 68/86 (79%), Positives = 78/86 (90%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQV+ VTGN+ILRILKA GLAP IPEDLYHLIKKAV++RKH+E+ RKDKD KF+LIL+ES Sbjct: 61 AQVRFVTGNKILRILKAKGLAPKIPEDLYHLIKKAVSVRKHMERNRKDKDSKFRLILIES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYYKT VLPPNW+YES +A Sbjct: 121 RIHRLARYYKTKRVLPPNWKYESSTA 146 >ref|XP_001391379.1| 40S ribosomal protein S13 [Aspergillus niger CBS 513.88] gi|134075851|emb|CAL00230.1| unnamed protein product [Aspergillus niger] gi|350635496|gb|EHA23857.1| hypothetical protein ASPNIDRAFT_200276 [Aspergillus niger ATCC 1015] gi|358369531|dbj|GAA86145.1| 40S ribosomal protein S13-1 [Aspergillus kawachii IFO 4308] Length = 151 Score = 144 bits (363), Expect = 3e-32 Identities = 67/86 (77%), Positives = 78/86 (90%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQVK+VTGN+ILRILK+NGLAP +PEDLYHLIKKAV +RKHLE+ RKDKD KF+LIL+ES Sbjct: 61 AQVKTVTGNKILRILKSNGLAPELPEDLYHLIKKAVAVRKHLERNRKDKDSKFRLILIES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRL+RYYK+ VLPP WRYES +A Sbjct: 121 RIHRLSRYYKSVGVLPPTWRYESATA 146 >emb|CCQ18649.1| 40S ribosomal protein S13 [Sycon ciliatum] Length = 173 Score = 144 bits (362), Expect = 3e-32 Identities = 69/86 (80%), Positives = 78/86 (90%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQVK VTGN+ILRILKA GLAP+IPEDLYHLIKKAV++RKH+EK RKDKD KF+LIL+ES Sbjct: 83 AQVKLVTGNKILRILKAKGLAPAIPEDLYHLIKKAVSVRKHMEKQRKDKDSKFRLILIES 142 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYYKT VLP NW+YES +A Sbjct: 143 RIHRLARYYKTRRVLPSNWKYESSTA 168 >ref|XP_014172534.1| splicing factor u2af large subunit [Grosmannia clavigera kw1407] gi|320590609|gb|EFX03052.1| splicing factor u2af large subunit [Grosmannia clavigera kw1407] Length = 420 Score = 144 bits (362), Expect = 3e-32 Identities = 70/86 (81%), Positives = 76/86 (88%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQVK VTGNRILRILK+NGLAP IPEDLY LIKKAV +RKHLE+ RKDKD KF+LIL+ES Sbjct: 330 AQVKIVTGNRILRILKSNGLAPDIPEDLYMLIKKAVAVRKHLERNRKDKDSKFRLILIES 389 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYYKT VLPP WRYES +A Sbjct: 390 RIHRLARYYKTVGVLPPTWRYESATA 415 >ref|XP_002420858.1| 40S ribosomal protein S13 [Candida dubliniensis CD36] gi|223644201|emb|CAX41011.1| ribosomal protein, small subunit, putative [Candida dubliniensis CD36] gi|703957698|gb|KGQ84060.1| 40S ribosomal protein S13 [Candida albicans P94015] gi|703959605|gb|KGQ85947.1| 40S ribosomal protein S13 [Candida albicans P37005] gi|703963447|gb|KGQ89755.1| 40S ribosomal protein S13 [Candida albicans GC75] gi|703975749|gb|KGR04814.1| 40S ribosomal protein S13 [Candida albicans P57072] gi|703978247|gb|KGR07290.1| 40S ribosomal protein S13 [Candida albicans P78048] gi|703981911|gb|KGR10916.1| 40S ribosomal protein S13 [Candida albicans P37037] gi|712678791|gb|KGT65940.1| 40S ribosomal protein S13 [Candida albicans 12C] gi|712855578|gb|KGU04663.1| 40S ribosomal protein S13 [Candida albicans P87] gi|712856294|gb|KGU05363.1| 40S ribosomal protein S13 [Candida albicans 19F] gi|712856770|gb|KGU05837.1| 40S ribosomal protein S13 [Candida albicans L26] gi|712874593|gb|KGU22509.1| 40S ribosomal protein S13 [Candida albicans P34048] gi|712877132|gb|KGU24959.1| 40S ribosomal protein S13 [Candida albicans P75063] gi|712877793|gb|KGU25613.1| 40S ribosomal protein S13 [Candida albicans P57055] gi|723157916|gb|KHC31987.1| 40S ribosomal protein S13 [Candida albicans P76055] gi|723158599|gb|KHC32665.1| 40S ribosomal protein S13 [Candida albicans P76067] gi|723160398|gb|KHC34445.1| 40S ribosomal protein S13 [Candida albicans Ca6] gi|723173637|gb|KHC47580.1| 40S ribosomal protein S13 [Candida albicans P60002] gi|723176325|gb|KHC50243.1| 40S ribosomal protein S13 [Candida albicans P37039] gi|723184338|gb|KHC58191.1| 40S ribosomal protein S13 [Candida albicans P75010] gi|723190194|gb|KHC64002.1| 40S ribosomal protein S13 [Candida albicans P75016] gi|723197800|gb|KHC71532.1| 40S ribosomal protein S13 [Candida albicans P78042] gi|723199498|gb|KHC73217.1| 40S ribosomal protein S13 [Candida albicans SC5314] gi|723211266|gb|KHC84892.1| 40S ribosomal protein S13 [Candida albicans SC5314] Length = 151 Score = 143 bits (361), Expect = 4e-32 Identities = 67/86 (77%), Positives = 79/86 (91%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 +Q K VTGN+ILRILK+NGLAP IPEDLY+LIKKAV++RKHLEK RKDKD KF+LIL+ES Sbjct: 61 SQAKVVTGNKILRILKSNGLAPEIPEDLYYLIKKAVSVRKHLEKNRKDKDSKFRLILIES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYY+T +VLPPNW+YES +A Sbjct: 121 RIHRLARYYRTVAVLPPNWKYESATA 146 >ref|XP_002493888.1| 40S ribosomal protein S13 [Komagataella phaffii GS115] gi|238033687|emb|CAY71709.1| Protein component of the small (40S) ribosomal subunit [Komagataella phaffii GS115] gi|328354291|emb|CCA40688.1| 40S ribosomal protein S13 [Komagataella phaffii CBS 7435] Length = 151 Score = 143 bits (361), Expect = 4e-32 Identities = 66/86 (76%), Positives = 80/86 (93%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQ + +TGN+ILRILK+NGLAP+IPEDLY+LIKKAV++RKHLE+ RKDKD KF+LIL+ES Sbjct: 61 AQTRFITGNKILRILKSNGLAPAIPEDLYYLIKKAVSVRKHLERNRKDKDSKFRLILIES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYY+T SVLPPNW+YES +A Sbjct: 121 RIHRLARYYRTVSVLPPNWKYESATA 146 >gb|KLU92798.1| 40S ribosomal protein S13 [Magnaporthiopsis poae ATCC 64411] Length = 151 Score = 143 bits (360), Expect = 6e-32 Identities = 69/86 (80%), Positives = 77/86 (89%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQVK VTGN+ILRILK+NGLAP IPEDLY LIKKAV++RKHLE+ RKDKD KF+LIL+ES Sbjct: 61 AQVKVVTGNKILRILKSNGLAPDIPEDLYMLIKKAVSVRKHLERNRKDKDSKFRLILIES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYYKT VLPP WRYES +A Sbjct: 121 RIHRLARYYKTVGVLPPTWRYESATA 146 >ref|XP_009496067.1| 40S ribosomal protein S13 [Fonticula alba] gi|627947546|gb|KCV69502.1| 40S ribosomal protein S13 [Fonticula alba] Length = 151 Score = 143 bits (360), Expect = 6e-32 Identities = 64/85 (75%), Positives = 79/85 (92%) Frame = -1 Query: 258 QVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVESR 79 +++S+TGN+I+RILKANGLAP IPEDLY L+KKAV++RKHLE+FRKDKD KF+LILVESR Sbjct: 62 KIQSITGNKIVRILKANGLAPEIPEDLYQLVKKAVSIRKHLERFRKDKDAKFRLILVESR 121 Query: 78 IHRLARYYKTASVLPPNWRYESGSA 4 IHRLARYY+TA +PPNW+YES +A Sbjct: 122 IHRLARYYRTAGTIPPNWKYESSTA 146 >gb|KNE61503.1| 40S ribosomal protein S13 [Allomyces macrogynus ATCC 38327] Length = 152 Score = 142 bits (359), Expect = 8e-32 Identities = 64/85 (75%), Positives = 78/85 (91%) Frame = -1 Query: 258 QVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVESR 79 QVK++TGN++LRILK+NGLAP IPEDLYHLIKKAV++RKH+E+ RKD+D KF+LIL+ESR Sbjct: 62 QVKTITGNKVLRILKSNGLAPEIPEDLYHLIKKAVSVRKHMERHRKDRDSKFRLILIESR 121 Query: 78 IHRLARYYKTASVLPPNWRYESGSA 4 IHRLARYYKTA LPP W+YES +A Sbjct: 122 IHRLARYYKTAGQLPPTWKYESSNA 146 >sp|P46298.1|RS13_PEA RecName: Full=40S ribosomal protein S13 gi|396639|emb|CAA80974.1| ribosomal protein S13 [Pisum sativum] Length = 151 Score = 142 bits (359), Expect = 8e-32 Identities = 69/86 (80%), Positives = 78/86 (90%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQVKSVTG++ILRILKA+GLAP IPEDLYHLIKKAV++RKHLE+FRKDKD KF+LILVES Sbjct: 61 AQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVSIRKHLERFRKDKDSKFRLILVES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYYK LPP W+YES +A Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTA 146 >ref|XP_006892104.1| PREDICTED: 40S ribosomal protein S13 [Elephantulus edwardii] Length = 151 Score = 142 bits (359), Expect = 8e-32 Identities = 67/86 (77%), Positives = 77/86 (89%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQV+ VTGN+ILRILK+ GLAP +PEDLYHLIKKAV +RKHLE+ RKDKD KF+LIL+ES Sbjct: 61 AQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERSRKDKDAKFRLILIES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYYKT VLPPNW+YES +A Sbjct: 121 RIHRLARYYKTKRVLPPNWKYESSTA 146 >gb|KDN63257.1| putative 40S ribosomal protein S13 [Colletotrichum sublineola] Length = 151 Score = 142 bits (359), Expect = 8e-32 Identities = 69/86 (80%), Positives = 76/86 (88%) Frame = -1 Query: 261 AQVKSVTGNRILRILKANGLAPSIPEDLYHLIKKAVTMRKHLEKFRKDKDQKFKLILVES 82 AQV+ VTGNRILRILK+NGLAP IPEDLY LIKKAV +RKHLE+ RKDKD KF+LIL+ES Sbjct: 61 AQVRVVTGNRILRILKSNGLAPDIPEDLYMLIKKAVAVRKHLERNRKDKDSKFRLILIES 120 Query: 81 RIHRLARYYKTASVLPPNWRYESGSA 4 RIHRLARYYKT VLPP WRYES +A Sbjct: 121 RIHRLARYYKTVGVLPPTWRYESATA 146