BLASTX nr result
ID: Cornus23_contig00039000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00039000 (415 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009771141.1| PREDICTED: uncharacterized protein LOC104221... 52 8e-06 >ref|XP_009771141.1| PREDICTED: uncharacterized protein LOC104221718 [Nicotiana sylvestris] Length = 146 Score = 52.0 bits (123), Expect(2) = 8e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = -2 Query: 261 LIIVNQCCMCKSDGKSVDHLLLHCPVARDSWGMILGLF 148 + +V+ C MCKS G+ VDHLLLHCPV+ W IL LF Sbjct: 93 ITLVSWCYMCKSSGEEVDHLLLHCPVSSALWRAILNLF 130 Score = 24.3 bits (51), Expect(2) = 8e-06 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 344 KAPLKVPFFAWTVVLG 297 KAP KV FFAW G Sbjct: 65 KAPTKVCFFAWLAARG 80