BLASTX nr result
ID: Cornus23_contig00038994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00038994 (378 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus tr... 100 3e-19 prf||1211235CE ORF 79 85 2e-14 ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabac... 85 2e-14 ref|YP_001430147.1| hypothetical protein CureCp061 [Cuscuta refl... 70 8e-10 ref|NP_054976.1| hypothetical protein SpolCp072 [Spinacia olerac... 60 5e-09 >ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus trichocarpa] gi|134093271|ref|YP_001109572.1| hypothetical protein Poptr_cp095 [Populus trichocarpa] gi|133712108|gb|ABO36751.1| conserved hypothetical protein [Populus trichocarpa] gi|133712133|gb|ABO36776.1| conserved hypothetical protein [Populus trichocarpa] Length = 61 Score = 100 bits (250), Expect = 3e-19 Identities = 51/61 (83%), Positives = 55/61 (90%), Gaps = 1/61 (1%) Frame = +1 Query: 1 ME*MTNVEC*SISIDRSCHIGPSWTSNCFDLNYPEDALYI-YQKDGQSNLFLNSIEAQRG 177 ME MT VEC SISIDRSCHIGPS TSNCFDLNYPEDAL I YQK+GQSNLFL+SIEA+RG Sbjct: 1 MEYMTKVECWSISIDRSCHIGPSQTSNCFDLNYPEDALSILYQKNGQSNLFLDSIEAKRG 60 Query: 178 K 180 + Sbjct: 61 E 61 >prf||1211235CE ORF 79 Length = 79 Score = 85.1 bits (209), Expect = 2e-14 Identities = 47/72 (65%), Positives = 53/72 (73%), Gaps = 2/72 (2%) Frame = +1 Query: 37 SIDRSCHIGPSWTSNCFDLNYPEDAL-YIYQKDGQSNLFLNSI-EAQRGK*GPK*REICK 210 SIDRSCHIGPSWTSNCFDLNYPE+A+ IYQKDGQSNLFL+S+ E R EICK Sbjct: 11 SIDRSCHIGPSWTSNCFDLNYPENAMPDIYQKDGQSNLFLDSLKEVNRVP-----IEICK 65 Query: 211 KKSRSDYYAIPN 246 K+ R + I N Sbjct: 66 KQVRLRVFLILN 77 >ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabacum] gi|11466029|ref|NP_054571.1| hypothetical protein NitaCp098 [Nicotiana tabacum] gi|78102586|ref|YP_358726.1| hypothetical protein NisyCp082 [Nicotiana sylvestris] gi|78102613|ref|YP_358752.1| hypothetical protein NisyCp111 [Nicotiana sylvestris] gi|81301616|ref|YP_398912.1| hypothetical protein NitoCp081 [Nicotiana tomentosiformis] gi|81301643|ref|YP_398938.1| hypothetical protein NitoCp109 [Nicotiana tomentosiformis] gi|351653909|ref|YP_004891655.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653954|ref|YP_004891681.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|4388760|emb|CAA77389.1| hypothetical protein [Nicotiana tabacum] gi|4388762|emb|CAA77404.1| hypothetical protein [Nicotiana tabacum] gi|77799613|dbj|BAE46702.1| hypothetical protein [Nicotiana sylvestris] gi|77799640|dbj|BAE46729.1| hypothetical protein [Nicotiana sylvestris] gi|80750975|dbj|BAE48051.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751002|dbj|BAE48078.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453935|gb|AEO95593.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453980|gb|AEO95638.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454046|gb|AEO95703.1| hypothetical protein [synthetic construct] gi|347454089|gb|AEO95746.1| hypothetical protein [synthetic construct] Length = 79 Score = 85.1 bits (209), Expect = 2e-14 Identities = 47/72 (65%), Positives = 53/72 (73%), Gaps = 2/72 (2%) Frame = +1 Query: 37 SIDRSCHIGPSWTSNCFDLNYPEDAL-YIYQKDGQSNLFLNSI-EAQRGK*GPK*REICK 210 SIDRSCHIGPSWTSNCFDLNYPE+A+ IYQKDGQSNLFL+S+ E R EICK Sbjct: 11 SIDRSCHIGPSWTSNCFDLNYPENAMPDIYQKDGQSNLFLDSLKEVNRVP-----IEICK 65 Query: 211 KKSRSDYYAIPN 246 K+ R + I N Sbjct: 66 KQVRLRVFLILN 77 >ref|YP_001430147.1| hypothetical protein CureCp061 [Cuscuta reflexa] gi|156618874|ref|YP_001430155.1| hypothetical protein CureCp070 [Cuscuta reflexa] gi|401482|sp|P32035.1|YCX1_CUSRE RecName: Full=Uncharacterized 6.8 kDa protein in trnL 3'region; AltName: Full=ORF 55 [Cuscuta reflexa] gi|12523|emb|CAA47850.1| unnamed protein product [Cuscuta reflexa] gi|156556051|emb|CAM98434.1| hypothetical protein [Cuscuta reflexa] gi|156556059|emb|CAM98442.1| hypothetical protein [Cuscuta reflexa] gi|1096970|prf||2113216D ORF 55 Length = 55 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +3 Query: 27 LEYFY*SIMSYRPELDI*LLRFELSGGCLIYISKRWTIKPISQFNR 164 +EY Y S+MSYR +LDI LLRFELSG CLI ISKRWTIKP+S+F + Sbjct: 7 VEYLYRSVMSYRTQLDIQLLRFELSGECLIDISKRWTIKPLSRFTQ 52 >ref|NP_054976.1| hypothetical protein SpolCp072 [Spinacia oleracea] gi|11497597|ref|NP_055003.1| hypothetical protein SpolCp101 [Spinacia oleracea] gi|7636149|emb|CAB88771.1| hypothetical protein (chloroplast) [Spinacia oleracea] gi|7636178|emb|CAB88800.1| hypothetical protein (chloroplast) [Spinacia oleracea] Length = 57 Score = 60.5 bits (145), Expect(2) = 5e-09 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +3 Query: 54 SYRPELDI*LLRFELSGGCLIYISKRWTIKPISQFNRSPKR 176 SYRP DI LLRF LSGG LIYISKRWTIK + +FNRS KR Sbjct: 17 SYRPGSDIQLLRFALSGGYLIYISKRWTIKLLFRFNRSLKR 57 Score = 26.9 bits (58), Expect(2) = 5e-09 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +1 Query: 1 ME*MTNVEC*SISIDRSCHIG 63 ME +T VEC SISIDRS G Sbjct: 1 MEYITKVECWSISIDRSYRPG 21