BLASTX nr result
ID: Cornus23_contig00038713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00038713 (427 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010909682.1| PREDICTED: histidine-containing phosphotrans... 57 7e-06 >ref|XP_010909682.1| PREDICTED: histidine-containing phosphotransfer protein 1-like isoform X3 [Elaeis guineensis] Length = 125 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = -1 Query: 178 TKRCMQALNKIMSEYFHLQSKFQTLVQMEGRVFAYETNQQ 59 + RCM+ALN + EY+HL+SKF+T++Q+E R+ AYET QQ Sbjct: 85 SSRCMRALNVVKHEYYHLRSKFETMLQLENRIQAYETKQQ 124