BLASTX nr result
ID: Cornus23_contig00038704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00038704 (278 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ30843.1| putative glycoside hydrolase family 61 protein [E... 71 4e-10 gb|EPQ65317.1| Glycosyl hydrolase family 61 [Blumeria graminis f... 61 4e-07 emb|CCU74678.1| CELP0027 Effector like protein [Blumeria gramini... 60 5e-07 >gb|KHJ30843.1| putative glycoside hydrolase family 61 protein [Erysiphe necator] Length = 379 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = -3 Query: 276 RGCKAYESKCAAIQSECHSGNFNGPPDQGKILTAGIRGRINSRGFKE 136 +GC+AYE KC+ +QS C SGN+NGPP+QG+ILTAG+RG I S + E Sbjct: 313 KGCRAYEKKCSTMQSGCKSGNYNGPPNQGQILTAGVRGNIKSIDYME 359 >gb|EPQ65317.1| Glycosyl hydrolase family 61 [Blumeria graminis f. sp. tritici 96224] Length = 388 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/51 (50%), Positives = 36/51 (70%), Gaps = 3/51 (5%) Frame = -3 Query: 276 RGCKAYESKCAAIQSECHSGNFNGPPDQGKILTAGIR---GRINSRGFKEM 133 +GC+ YE+KC +Q C SGNFNGPPDQG+ILT GI+ G N+ + ++ Sbjct: 311 KGCRLYENKCTKMQQGCGSGNFNGPPDQGQILTPGIKDSHGSQNTAAYSDL 361 >emb|CCU74678.1| CELP0027 Effector like protein [Blumeria graminis f. sp. hordei DH14] Length = 388 Score = 60.5 bits (145), Expect = 5e-07 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -3 Query: 276 RGCKAYESKCAAIQSECHSGNFNGPPDQGKILTAGIR 166 +GC+ YE KC +Q C SGNFNGPPDQG++LT GI+ Sbjct: 311 KGCRVYEKKCTKMQQACGSGNFNGPPDQGQVLTPGIK 347