BLASTX nr result
ID: Cornus23_contig00038625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00038625 (381 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001589111.1| hypothetical protein SS1G_09744 [Sclerotinia... 59 1e-06 gb|KOM21114.1| hypothetical protein XA68_1819 [Ophiocordyceps un... 59 2e-06 gb|KIN08245.1| hypothetical protein OIDMADRAFT_175100 [Oidiodend... 57 4e-06 gb|KHN98144.1| heat shock 70 kDa protein precursor [Metarhizium ... 57 4e-06 gb|KFY52730.1| hypothetical protein V496_08221 [Pseudogymnoascus... 57 4e-06 emb|CCD55340.1| similar to mitochondrial heat shock protein [Bot... 57 4e-06 ref|XP_007807061.1| heat shock 70 kDa protein precursor [Metarhi... 57 4e-06 ref|XP_001549629.1| hypothetical protein BC1G_11661 [Botrytis ci... 57 4e-06 gb|KND92983.1| Heat shock 70 kDa protein [Tolypocladium ophioglo... 57 7e-06 gb|KLU81770.1| hsp70-like protein [Magnaporthiopsis poae ATCC 64... 57 7e-06 gb|KJZ79913.1| Heat shock 70 kDa protein [Hirsutella minnesotens... 57 7e-06 gb|ESZ95491.1| heat shock 70 kDa protein [Sclerotinia borealis F... 57 7e-06 ref|XP_007794561.1| putative hsp70-like protein [Eutypa lata UCR... 57 7e-06 >ref|XP_001589111.1| hypothetical protein SS1G_09744 [Sclerotinia sclerotiorum 1980] gi|154694139|gb|EDN93877.1| hypothetical protein SS1G_09744 [Sclerotinia sclerotiorum 1980 UF-70] Length = 674 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 K+QSG+GTV++ ELKEKTDELQMASLNLFDK+H Sbjct: 612 KSQSGEGTVTAAELKEKTDELQMASLNLFDKMH 644 >gb|KOM21114.1| hypothetical protein XA68_1819 [Ophiocordyceps unilateralis] Length = 683 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 KNQSG+GT ++ E+KEKTDELQMASLNLFDK+H Sbjct: 615 KNQSGEGTATAAEIKEKTDELQMASLNLFDKMH 647 >gb|KIN08245.1| hypothetical protein OIDMADRAFT_175100 [Oidiodendron maius Zn] Length = 679 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 K+QSG+GT ++ ELKEKTDELQMASLNLFDK+H Sbjct: 616 KSQSGEGTATAAELKEKTDELQMASLNLFDKMH 648 >gb|KHN98144.1| heat shock 70 kDa protein precursor [Metarhizium album ARSEF 1941] Length = 680 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 K+QSG+GT +++E+KEKTDELQMASLNLFDK+H Sbjct: 618 KSQSGEGTATAEEIKEKTDELQMASLNLFDKMH 650 >gb|KFY52730.1| hypothetical protein V496_08221 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] gi|682429030|gb|KFY95536.1| hypothetical protein V498_03308 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] Length = 676 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 K+QSG+GT ++ ELKEKTDELQMASLNLFDK+H Sbjct: 618 KSQSGEGTATAAELKEKTDELQMASLNLFDKMH 650 >emb|CCD55340.1| similar to mitochondrial heat shock protein [Botrytis cinerea T4] Length = 679 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 K+QSG+GT ++ ELKEKTDELQMASLNLFDK+H Sbjct: 617 KSQSGEGTATAAELKEKTDELQMASLNLFDKMH 649 >ref|XP_007807061.1| heat shock 70 kDa protein precursor [Metarhizium acridum CQMa 102] gi|322701734|gb|EFY93483.1| heat shock 70 kDa protein precursor [Metarhizium acridum CQMa 102] Length = 678 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 K+QSG+GT +++E+KEKTDELQMASLNLFDK+H Sbjct: 618 KSQSGEGTATAEEIKEKTDELQMASLNLFDKMH 650 >ref|XP_001549629.1| hypothetical protein BC1G_11661 [Botrytis cinerea B05.10] gi|472239922|gb|EMR84711.1| putative hsp70-like protein [Botrytis cinerea BcDW1] Length = 679 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 K+QSG+GT ++ ELKEKTDELQMASLNLFDK+H Sbjct: 617 KSQSGEGTATAAELKEKTDELQMASLNLFDKMH 649 >gb|KND92983.1| Heat shock 70 kDa protein [Tolypocladium ophioglossoides CBS 100239] Length = 681 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 K+QSG+GT ++ E+KEKTDELQMASLNLFDK+H Sbjct: 620 KSQSGEGTATAAEIKEKTDELQMASLNLFDKMH 652 >gb|KLU81770.1| hsp70-like protein [Magnaporthiopsis poae ATCC 64411] Length = 673 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 KNQSG+GT ++ ELKEKTDELQ ASLNLFDK+H Sbjct: 615 KNQSGEGTATAAELKEKTDELQNASLNLFDKMH 647 >gb|KJZ79913.1| Heat shock 70 kDa protein [Hirsutella minnesotensis 3608] Length = 680 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 K+QSG+GT ++ E+KEKTDELQMASLNLFDK+H Sbjct: 619 KSQSGEGTATAAEIKEKTDELQMASLNLFDKMH 651 >gb|ESZ95491.1| heat shock 70 kDa protein [Sclerotinia borealis F-4157] Length = 676 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 K+QSG+G V++ ELKEKTDELQMASLNLFDK+H Sbjct: 617 KSQSGEGLVTAAELKEKTDELQMASLNLFDKMH 649 >ref|XP_007794561.1| putative hsp70-like protein [Eutypa lata UCREL1] gi|471565869|gb|EMR66343.1| putative hsp70-like protein [Eutypa lata UCREL1] Length = 672 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 379 KNQSGDGTVSSKELKEKTDELQMASLNLFDKIH 281 K+QSG+GT ++ E+KEKTDELQMASLNLFDK+H Sbjct: 615 KSQSGEGTATAAEIKEKTDELQMASLNLFDKMH 647