BLASTX nr result
ID: Cornus23_contig00038271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00038271 (314 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001799168.1| hypothetical protein SNOG_08864 [Parastagono... 72 1e-10 ref|XP_003837539.1| similar to dipeptidyl-peptidase IV [Leptosph... 69 2e-09 ref|XP_007691747.1| hypothetical protein COCMIDRAFT_8608 [Bipola... 63 8e-08 ref|XP_008025390.1| hypothetical protein SETTUDRAFT_88934 [Setos... 63 1e-07 ref|XP_014562533.1| hypothetical protein COCVIDRAFT_21497 [Bipol... 62 2e-07 ref|XP_001939353.1| seprase [Pyrenophora tritici-repentis Pt-1C-... 61 3e-07 gb|KNG48895.1| dipeptidyl peptidase 4 [Stemphylium lycopersici] 60 5e-07 ref|XP_003303732.1| hypothetical protein PTT_16074 [Pyrenophora ... 59 1e-06 ref|XP_014084660.1| hypothetical protein COCC4DRAFT_46427 [Bipol... 58 2e-06 ref|XP_007694263.1| hypothetical protein COCSADRAFT_32329 [Bipol... 58 3e-06 ref|XP_007711885.1| hypothetical protein COCCADRAFT_4698 [Bipola... 57 7e-06 >ref|XP_001799168.1| hypothetical protein SNOG_08864 [Parastagonospora nodorum SN15] gi|111062912|gb|EAT84032.1| hypothetical protein SNOG_08864 [Parastagonospora nodorum SN15] Length = 783 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -1 Query: 128 MLTLALFTAVLPLVHAITPPRFPHQPLGNGTRRLTYNITTDA 3 M T A A LPL+ AITPPRFPHQPLGNGT+RLTYNITTDA Sbjct: 1 MRTFAFCAAALPLISAITPPRFPHQPLGNGTKRLTYNITTDA 42 >ref|XP_003837539.1| similar to dipeptidyl-peptidase IV [Leptosphaeria maculans JN3] gi|312214097|emb|CBX94099.1| similar to dipeptidyl-peptidase IV [Leptosphaeria maculans JN3] Length = 781 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 128 MLTLALFTAVLPLVHAITPPRFPHQPLGNGTRRLTYNITTDA 3 M + A+ A LP +HAI PPR PHQPLGNGT+RLTYNITTDA Sbjct: 1 MRSFAVLAAALPWIHAIEPPRMPHQPLGNGTKRLTYNITTDA 42 >ref|XP_007691747.1| hypothetical protein COCMIDRAFT_8608 [Bipolaris oryzae ATCC 44560] gi|576928071|gb|EUC41728.1| hypothetical protein COCMIDRAFT_8608 [Bipolaris oryzae ATCC 44560] Length = 783 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -1 Query: 128 MLTLALFTAVLPLVHAITPPRFPHQPLGNGTRRLTYNITT 9 M + AL AVLPLVHAI PPR PHQPLGNG++RL+YN TT Sbjct: 1 MRSFALLAAVLPLVHAIEPPRKPHQPLGNGSKRLSYNETT 40 >ref|XP_008025390.1| hypothetical protein SETTUDRAFT_88934 [Setosphaeria turcica Et28A] gi|482809986|gb|EOA86792.1| hypothetical protein SETTUDRAFT_88934 [Setosphaeria turcica Et28A] Length = 780 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -1 Query: 128 MLTLALFTAVLPLVHAITPPRFPHQPLGNGTRRLTYNITTD 6 M +L L A LPL AI PPR PHQPLGNGT+RLTYN TTD Sbjct: 1 MRSLLLLAAALPLTQAIEPPRVPHQPLGNGTKRLTYNETTD 41 >ref|XP_014562533.1| hypothetical protein COCVIDRAFT_21497 [Bipolaris victoriae FI3] gi|578495620|gb|EUN33001.1| hypothetical protein COCVIDRAFT_21497 [Bipolaris victoriae FI3] Length = 782 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 128 MLTLALFTAVLPLVHAITPPRFPHQPLGNGTRRLTYNITT 9 M + AL TAVLPL+ AI PPR PHQPLGNG++RL+YN TT Sbjct: 1 MRSFALLTAVLPLIQAIEPPRKPHQPLGNGSKRLSYNETT 40 >ref|XP_001939353.1| seprase [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187975446|gb|EDU42072.1| seprase [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 779 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -1 Query: 128 MLTLALFTAVLPLVHAITPPRFPHQPLGNGTRRLTYNITT 9 M + AL AVLPLV AI PPR PHQPLGNGT+RL+YN +T Sbjct: 1 MRSFALLAAVLPLVQAIEPPRMPHQPLGNGTKRLSYNEST 40 >gb|KNG48895.1| dipeptidyl peptidase 4 [Stemphylium lycopersici] Length = 781 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 128 MLTLALFTAVLPLVHAITPPRFPHQPLGNGTRRLTYNITTD 6 M + AL AVLPL+ AI PPR PHQPLGNG++ L+YN TTD Sbjct: 1 MRSFALLAAVLPLIQAIDPPRMPHQPLGNGSKLLSYNETTD 41 >ref|XP_003303732.1| hypothetical protein PTT_16074 [Pyrenophora teres f. teres 0-1] gi|311320043|gb|EFQ88159.1| hypothetical protein PTT_16074 [Pyrenophora teres f. teres 0-1] Length = 779 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -1 Query: 128 MLTLALFTAVLPLVHAITPPRFPHQPLGNGTRRLTYNITT 9 M AL AVLPL+ AI PPR PHQPLGNGT+RL+YN +T Sbjct: 1 MRPFALLAAVLPLIQAIEPPRRPHQPLGNGTKRLSYNEST 40 >ref|XP_014084660.1| hypothetical protein COCC4DRAFT_46427 [Bipolaris maydis ATCC 48331] gi|452003435|gb|EMD95892.1| hypothetical protein COCHEDRAFT_1166505 [Bipolaris maydis C5] gi|477593682|gb|ENI10751.1| hypothetical protein COCC4DRAFT_46427 [Bipolaris maydis ATCC 48331] Length = 782 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -1 Query: 128 MLTLALFTAVLPLVHAITPPRFPHQPLGNGTRRLTYNITT 9 M + L AVLPL+ AI PPR PHQPLGNG++RL+YN TT Sbjct: 1 MRSFTLLAAVLPLIQAIEPPRQPHQPLGNGSKRLSYNETT 40 >ref|XP_007694263.1| hypothetical protein COCSADRAFT_32329 [Bipolaris sorokiniana ND90Pr] gi|451856355|gb|EMD69646.1| hypothetical protein COCSADRAFT_32329 [Bipolaris sorokiniana ND90Pr] Length = 782 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -1 Query: 128 MLTLALFTAVLPLVHAITPPRFPHQPLGNGTRRLTYNITT 9 M + A A+LPL+ AI PPR PHQPLGNG++RL+YN TT Sbjct: 1 MRSFAFLAAILPLIQAIEPPRKPHQPLGNGSKRLSYNETT 40 >ref|XP_007711885.1| hypothetical protein COCCADRAFT_4698 [Bipolaris zeicola 26-R-13] gi|576919591|gb|EUC33762.1| hypothetical protein COCCADRAFT_4698 [Bipolaris zeicola 26-R-13] Length = 782 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -1 Query: 128 MLTLALFTAVLPLVHAITPPRFPHQPLGNGTRRLTYNITT 9 M + AL AVLPL+ AI P R PHQPLGNG++RL+YN TT Sbjct: 1 MRSFALLAAVLPLIQAIEPARKPHQPLGNGSKRLSYNETT 40