BLASTX nr result
ID: Cornus23_contig00038203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00038203 (383 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010064853.1| PREDICTED: GDSL esterase/lipase At1g71691 [E... 44 3e-07 >ref|XP_010064853.1| PREDICTED: GDSL esterase/lipase At1g71691 [Eucalyptus grandis] Length = 502 Score = 44.3 bits (103), Expect(2) = 3e-07 Identities = 20/41 (48%), Positives = 30/41 (73%) Frame = -3 Query: 192 IPENKKVKLVAYKLKGITFNWWENL*VTRALRKKAPVRFYD 70 I E+++VKLVAYKLKG T WWE +T+ + KAP++ ++ Sbjct: 79 IEEDRQVKLVAYKLKGGTSAWWEQTQLTQRRQGKAPIQTWN 119 Score = 37.0 bits (84), Expect(2) = 3e-07 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -1 Query: 263 DGLFHVEDFLDWLEDFEKFFDYM 195 DG ++EDFLDWL + EKFFD M Sbjct: 55 DGNLNIEDFLDWLWEVEKFFDAM 77