BLASTX nr result
ID: Cornus23_contig00038149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00038149 (387 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006401947.1| hypothetical protein EUTSA_v10015949mg, part... 58 2e-06 >ref|XP_006401947.1| hypothetical protein EUTSA_v10015949mg, partial [Eutrema salsugineum] gi|557103037|gb|ESQ43400.1| hypothetical protein EUTSA_v10015949mg, partial [Eutrema salsugineum] Length = 251 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 184 SKKKSWPETILMVLISGRNNKNQSPGWLVSLVIGGF 291 S + SW ETILMVLISGRNNKNQSPG LVSLVIG + Sbjct: 176 SYENSWLETILMVLISGRNNKNQSPGRLVSLVIGDY 211