BLASTX nr result
ID: Cornus23_contig00038139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00038139 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ33161.1| putative annexin anxc4 [Erysiphe necator] 61 3e-07 >gb|KHJ33161.1| putative annexin anxc4 [Erysiphe necator] Length = 678 Score = 61.2 bits (147), Expect = 3e-07 Identities = 36/94 (38%), Positives = 48/94 (51%), Gaps = 8/94 (8%) Frame = -3 Query: 260 KDDPLAYGSFNTDHLAYPETPCSKA-----PSETSRSRPASIRYSSPPS---NPSDYFQP 105 KDDPLAYGSFN++HLAYP+ P ++ ET R+RP S+ Y S P P Sbjct: 183 KDDPLAYGSFNSNHLAYPDPPSRRSYADVPRQETFRNRPTSVIYDSLPPIAIKPDPMLSS 242 Query: 104 RSYQIHPDLADLTRRHLSLNPNEPCHKSRGHQSA 3 + Y DL+ SL +P H G +S+ Sbjct: 243 QRYDTTSSPLDLSLNMQSLQVIDPHHIGNGAESS 276