BLASTX nr result
ID: Cornus23_contig00038070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00038070 (618 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KGN66553.1| hypothetical protein Csa_1G629100 [Cucumis sativus] 128 2e-27 ref|XP_004139064.1| PREDICTED: pentatricopeptide repeat-containi... 127 4e-27 ref|XP_008450338.1| PREDICTED: pentatricopeptide repeat-containi... 126 1e-26 ref|XP_009624549.1| PREDICTED: pentatricopeptide repeat-containi... 125 2e-26 ref|XP_012838295.1| PREDICTED: pentatricopeptide repeat-containi... 124 5e-26 ref|XP_006470532.1| PREDICTED: pentatricopeptide repeat-containi... 121 3e-25 ref|XP_006446306.1| hypothetical protein CICLE_v10016520mg [Citr... 121 3e-25 ref|XP_013641129.1| PREDICTED: pentatricopeptide repeat-containi... 120 5e-25 ref|XP_013583831.1| PREDICTED: pentatricopeptide repeat-containi... 120 6e-25 ref|XP_009796553.1| PREDICTED: pentatricopeptide repeat-containi... 120 6e-25 ref|XP_012065875.1| PREDICTED: pentatricopeptide repeat-containi... 120 8e-25 ref|XP_013708368.1| PREDICTED: pentatricopeptide repeat-containi... 119 1e-24 ref|XP_010045065.1| PREDICTED: pentatricopeptide repeat-containi... 119 1e-24 ref|XP_009350240.1| PREDICTED: pentatricopeptide repeat-containi... 119 1e-24 ref|XP_009148044.1| PREDICTED: pentatricopeptide repeat-containi... 119 1e-24 ref|XP_011072170.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 ref|XP_008347474.1| PREDICTED: uncharacterized protein LOC103410... 117 7e-24 ref|XP_010045074.1| PREDICTED: pentatricopeptide repeat-containi... 116 9e-24 ref|XP_010045066.1| PREDICTED: pentatricopeptide repeat-containi... 116 9e-24 ref|XP_004291779.1| PREDICTED: pentatricopeptide repeat-containi... 116 1e-23 >gb|KGN66553.1| hypothetical protein Csa_1G629100 [Cucumis sativus] Length = 130 Score = 128 bits (322), Expect = 2e-27 Identities = 71/120 (59%), Positives = 85/120 (70%), Gaps = 3/120 (2%) Frame = -3 Query: 352 MLRLGQNLLRRASHTFTEQIIYRPLKTLDFPNHEL---EWLVRYITGSASSPSLSIWRRK 182 MLRL NLLR+ S + + F N +L + L+R+ITGSASSPSLSIWRRK Sbjct: 1 MLRLAPNLLRKISSSPISSTPFHRFSLSTFLNLDLLQQQLLLRFITGSASSPSLSIWRRK 60 Query: 181 KEMGEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 KEMG+EGLIV KELKRLQS+ R +RFI SHVSRLL+SDL+ VL E QR+ +FLC K H Sbjct: 61 KEMGKEGLIVVKELKRLQSNFIRLDRFISSHVSRLLKSDLVAVLVELQRQNHVFLCMKSH 120 >ref|XP_004139064.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Cucumis sativus] Length = 256 Score = 127 bits (320), Expect = 4e-27 Identities = 70/120 (58%), Positives = 86/120 (71%), Gaps = 3/120 (2%) Frame = -3 Query: 352 MLRLGQNLLRRASHTFTEQIIYRPLKTLDFPNHEL---EWLVRYITGSASSPSLSIWRRK 182 MLRL NLLR+ S + + F N +L + L+R+ITGSASSPSLSIWRRK Sbjct: 1 MLRLAPNLLRKISSSPISSTPFHRFSLSTFLNLDLLQQQLLLRFITGSASSPSLSIWRRK 60 Query: 181 KEMGEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 KEMG+EGLIV KELKRLQS+ R +RFI SHVSRLL+SDL+ VL E QR+ +FLC K++ Sbjct: 61 KEMGKEGLIVVKELKRLQSNFIRLDRFISSHVSRLLKSDLVAVLVELQRQNHVFLCMKLY 120 >ref|XP_008450338.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Cucumis melo] Length = 256 Score = 126 bits (316), Expect = 1e-26 Identities = 69/120 (57%), Positives = 85/120 (70%), Gaps = 3/120 (2%) Frame = -3 Query: 352 MLRLGQNLLRRASHTFTEQIIYRPLKTLDFPNHEL---EWLVRYITGSASSPSLSIWRRK 182 MLRL NLLR+ S + + F N +L + L+R+I GSASSPSLSIWRRK Sbjct: 1 MLRLAPNLLRKISSSPVSSTPFHRFSLSTFLNLDLLQQQLLLRFIAGSASSPSLSIWRRK 60 Query: 181 KEMGEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 KEMG+EGLIV KELKRLQS+ R +RFI SHVSRLL+SDL+ VL E QR+ +FLC K++ Sbjct: 61 KEMGKEGLIVVKELKRLQSNFIRLDRFISSHVSRLLKSDLVAVLVELQRQNHVFLCMKLY 120 >ref|XP_009624549.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Nicotiana tomentosiformis] Length = 246 Score = 125 bits (314), Expect = 2e-26 Identities = 72/119 (60%), Positives = 88/119 (73%), Gaps = 2/119 (1%) Frame = -3 Query: 352 MLRLGQNLLRRASHTFTEQIIYRPLKTLDFPNHELEWLVRYITGSASS--PSLSIWRRKK 179 M R GQNLLRRAS L L ++ + + ITGSASS PS+SIWRRKK Sbjct: 1 MWRQGQNLLRRASPI---------LIVLPHSSNSSYGIRQIITGSASSSSPSVSIWRRKK 51 Query: 178 EMGEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 EMG+EGL+VAKELKRLQS+P RFERFIKSHVSRLL+SDL+ VLAEFQR+ L++L +++ Sbjct: 52 EMGKEGLMVAKELKRLQSNPVRFERFIKSHVSRLLKSDLVAVLAEFQRQDLVYLSMRLY 110 >ref|XP_012838295.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Erythranthe guttatus] gi|604331088|gb|EYU35946.1| hypothetical protein MIMGU_mgv1a017987mg [Erythranthe guttata] Length = 243 Score = 124 bits (310), Expect = 5e-26 Identities = 69/117 (58%), Positives = 88/117 (75%) Frame = -3 Query: 352 MLRLGQNLLRRASHTFTEQIIYRPLKTLDFPNHELEWLVRYITGSASSPSLSIWRRKKEM 173 M R GQNLLRRAS +Q+ +RP ++ + + ITG+ASSPSLSIWRRKKEM Sbjct: 1 MWRQGQNLLRRASSR-RQQLQHRP---------QITDVRQLITGAASSPSLSIWRRKKEM 50 Query: 172 GEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 G+EGL+VAKELKRLQ P RFERF+K++VSRLL+SDL+ VL EFQR+ L+ L K++ Sbjct: 51 GKEGLMVAKELKRLQCHPVRFERFMKTNVSRLLKSDLVAVLVEFQRQNLVSLSMKLY 107 >ref|XP_006470532.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Citrus sinensis] Length = 234 Score = 121 bits (304), Expect = 3e-25 Identities = 62/94 (65%), Positives = 75/94 (79%) Frame = -3 Query: 283 PLKTLDFPNHELEWLVRYITGSASSPSLSIWRRKKEMGEEGLIVAKELKRLQSSPARFER 104 P + F + L R I+GSASSPSLSIWRRKKEM +E L+VAKELKRLQS P RF+R Sbjct: 5 PKSSFSFSSLRKLILTRDISGSASSPSLSIWRRKKEMSKESLMVAKELKRLQSHPVRFDR 64 Query: 103 FIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 FIKSHVSRLL+SDL++VLAEFQR+ +FLC K++ Sbjct: 65 FIKSHVSRLLKSDLVSVLAEFQRQDQVFLCMKLY 98 >ref|XP_006446306.1| hypothetical protein CICLE_v10016520mg [Citrus clementina] gi|557548917|gb|ESR59546.1| hypothetical protein CICLE_v10016520mg [Citrus clementina] Length = 234 Score = 121 bits (304), Expect = 3e-25 Identities = 62/94 (65%), Positives = 75/94 (79%) Frame = -3 Query: 283 PLKTLDFPNHELEWLVRYITGSASSPSLSIWRRKKEMGEEGLIVAKELKRLQSSPARFER 104 P + F + L R I+GSASSPSLSIWRRKKEM +E L+VAKELKRLQS P RF+R Sbjct: 5 PKSSFSFSSLRKLILTRDISGSASSPSLSIWRRKKEMSKESLMVAKELKRLQSHPVRFDR 64 Query: 103 FIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 FIKSHVSRLL+SDL++VLAEFQR+ +FLC K++ Sbjct: 65 FIKSHVSRLLKSDLVSVLAEFQRQDQVFLCMKLY 98 >ref|XP_013641129.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Brassica napus] gi|923640685|ref|XP_013641130.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Brassica napus] gi|923640689|ref|XP_013641131.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Brassica napus] gi|674939925|emb|CDX93605.1| BnaA06g04430D [Brassica napus] Length = 248 Score = 120 bits (302), Expect = 5e-25 Identities = 63/110 (57%), Positives = 82/110 (74%) Frame = -3 Query: 331 LLRRASHTFTEQIIYRPLKTLDFPNHELEWLVRYITGSASSPSLSIWRRKKEMGEEGLIV 152 LLRR H+ + + L+ + F N +L + Y++G ASSPSLSIWRRKKEM +EGLI Sbjct: 4 LLRRVKHSIPQSFFF--LRQIGFSNSDLT-VRSYLSGPASSPSLSIWRRKKEMSKEGLIA 60 Query: 151 AKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 AKELKRLQ+ R +RFI SHVSRLL+SDL++VLAEFQR+ +FLC K++ Sbjct: 61 AKELKRLQTKLVRLDRFIASHVSRLLKSDLVSVLAEFQRQDQVFLCMKLY 110 >ref|XP_013583831.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Brassica oleracea var. oleracea] Length = 247 Score = 120 bits (301), Expect = 6e-25 Identities = 63/110 (57%), Positives = 82/110 (74%) Frame = -3 Query: 331 LLRRASHTFTEQIIYRPLKTLDFPNHELEWLVRYITGSASSPSLSIWRRKKEMGEEGLIV 152 LLRR H+ + + L+ + F N +L + Y++G ASSPSLSIWRRKKEM +EGLI Sbjct: 4 LLRRVKHSIPQSFL---LRQIGFANSDLT-VRSYLSGPASSPSLSIWRRKKEMSKEGLIA 59 Query: 151 AKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 AKELKRLQ+ R +RFI SHVSRLL+SDL++VLAEFQR+ +FLC K++ Sbjct: 60 AKELKRLQTKLVRLDRFISSHVSRLLKSDLVSVLAEFQRQDQVFLCMKLY 109 >ref|XP_009796553.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Nicotiana sylvestris] gi|698501729|ref|XP_009796554.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Nicotiana sylvestris] Length = 246 Score = 120 bits (301), Expect = 6e-25 Identities = 70/119 (58%), Positives = 87/119 (73%), Gaps = 2/119 (1%) Frame = -3 Query: 352 MLRLGQNLLRRASHTFTEQIIYRPLKTLDFPNHELEWLVRYITGSASS--PSLSIWRRKK 179 M R GQNL+RRAS L L ++ + + ITGS+SS PS+SIWRRKK Sbjct: 1 MWRQGQNLVRRASPR---------LIVLPHSSNSSFGIRQIITGSSSSSSPSVSIWRRKK 51 Query: 178 EMGEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 EMG+EGL+VAKELKRLQS+P RFERFIKSHVSRLL+SDL+ VLAEFQR+ L+ L +++ Sbjct: 52 EMGKEGLMVAKELKRLQSNPIRFERFIKSHVSRLLKSDLVAVLAEFQRQDLVSLSMRLY 110 >ref|XP_012065875.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Jatropha curcas] gi|802558881|ref|XP_012065877.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Jatropha curcas] gi|802558883|ref|XP_012065878.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Jatropha curcas] gi|802558885|ref|XP_012065879.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Jatropha curcas] gi|802558887|ref|XP_012065880.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Jatropha curcas] gi|802558889|ref|XP_012065881.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Jatropha curcas] gi|802558891|ref|XP_012065882.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Jatropha curcas] Length = 267 Score = 120 bits (300), Expect = 8e-25 Identities = 68/129 (52%), Positives = 88/129 (68%), Gaps = 18/129 (13%) Frame = -3 Query: 334 NLLRR---ASHTFTEQIIYRPLKTLDFPNH---------------ELEWLVRYITGSASS 209 NLLRR +S + T + + PL+ L + H +L L ++I+ +S Sbjct: 5 NLLRRISSSSSSRTPLVSHSPLENLHYQTHLFSKINSVKDQKKQQQLFILSQHISNLSSK 64 Query: 208 PSLSIWRRKKEMGEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRY 29 PSLSIWRRKKEMG+EGLIVAKELKRLQS+P R + FIKSHVSRLL+SDL+ VLAEFQR+ Sbjct: 65 PSLSIWRRKKEMGKEGLIVAKELKRLQSNPVRLDWFIKSHVSRLLKSDLVAVLAEFQRQD 124 Query: 28 LIFLCTKIH 2 +FLC K++ Sbjct: 125 QVFLCMKLY 133 >ref|XP_013708368.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Brassica napus] gi|674938485|emb|CDX95111.1| BnaC05g05600D [Brassica napus] Length = 248 Score = 119 bits (299), Expect = 1e-24 Identities = 63/110 (57%), Positives = 81/110 (73%) Frame = -3 Query: 331 LLRRASHTFTEQIIYRPLKTLDFPNHELEWLVRYITGSASSPSLSIWRRKKEMGEEGLIV 152 LLRR H+ + L+ + F N +L + Y++G ASSPSLSIWRRKKEM +EGLI Sbjct: 4 LLRRVKHSIPQSFFL--LRQIGFANSDLT-VRSYLSGPASSPSLSIWRRKKEMSKEGLIA 60 Query: 151 AKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 AKELKRLQ+ R +RFI SHVSRLL+SDL++VLAEFQR+ +FLC K++ Sbjct: 61 AKELKRLQTKLVRLDRFISSHVSRLLKSDLVSVLAEFQRQDQVFLCMKLY 110 >ref|XP_010045065.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X1 [Eucalyptus grandis] Length = 288 Score = 119 bits (298), Expect = 1e-24 Identities = 68/142 (47%), Positives = 93/142 (65%), Gaps = 10/142 (7%) Frame = -3 Query: 397 FQTKHTHFLFPSV----------FTMLRLGQNLLRRASHTFTEQIIYRPLKTLDFPNHEL 248 F T +TH +F S + ++ Q LR F + L +L + + Sbjct: 12 FSTSNTHLIFISSKGIGWTSAQSWFSSKMIQTALRNQHLLFHNNLAKHRLLSLLLLSPQT 71 Query: 247 EWLVRYITGSASSPSLSIWRRKKEMGEEGLIVAKELKRLQSSPARFERFIKSHVSRLLES 68 + + +Y+ + SSPSLSIWRRKKE+G+EGLIVAKELKR+QS+P R +RFIKSHVSRLL+S Sbjct: 72 QQISQYVR-TTSSPSLSIWRRKKEIGKEGLIVAKELKRIQSNPVRLDRFIKSHVSRLLKS 130 Query: 67 DLITVLAEFQRRYLIFLCTKIH 2 DLI+VLAEFQR+ +FLC K++ Sbjct: 131 DLISVLAEFQRQDQVFLCMKLY 152 >ref|XP_009350240.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X1 [Pyrus x bretschneideri] Length = 279 Score = 119 bits (298), Expect = 1e-24 Identities = 74/124 (59%), Positives = 88/124 (70%), Gaps = 7/124 (5%) Frame = -3 Query: 352 MLRLGQNLLRRASHTFTEQIIYRPLKTLDFPNHEL---EWLVRYITGS----ASSPSLSI 194 MLRL QNL+RR+S T T + P LD H L L RY +G ASSPSLSI Sbjct: 21 MLRLVQNLVRRSSPT-TPALSPSP-PYLDLSVHLLLQNTCLQRYFSGGSKALASSPSLSI 78 Query: 193 WRRKKEMGEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLC 14 WRRKKEMG+EGL+VAKELKRL+S P R + FI+SHVSRLL+SDL+ VLAEFQR+ +FL Sbjct: 79 WRRKKEMGKEGLMVAKELKRLRSQPLRLDHFIRSHVSRLLKSDLLAVLAEFQRQDQVFLS 138 Query: 13 TKIH 2 KI+ Sbjct: 139 MKIY 142 >ref|XP_009148044.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Brassica rapa] Length = 247 Score = 119 bits (298), Expect = 1e-24 Identities = 63/110 (57%), Positives = 81/110 (73%) Frame = -3 Query: 331 LLRRASHTFTEQIIYRPLKTLDFPNHELEWLVRYITGSASSPSLSIWRRKKEMGEEGLIV 152 LLRR H+ + L+ + F N +L + Y++G ASSPSLSIWRRKKEM +EGLI Sbjct: 4 LLRRVKHSIPQSFF---LRQIGFANSDLT-VRSYLSGPASSPSLSIWRRKKEMSKEGLIA 59 Query: 151 AKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 AKELKRLQ+ R +RFI SHVSRLL+SDL++VLAEFQR+ +FLC K++ Sbjct: 60 AKELKRLQTKLVRLDRFIASHVSRLLKSDLVSVLAEFQRQDQVFLCMKLY 109 >ref|XP_011072170.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Sesamum indicum] Length = 230 Score = 118 bits (296), Expect = 2e-24 Identities = 68/117 (58%), Positives = 83/117 (70%) Frame = -3 Query: 352 MLRLGQNLLRRASHTFTEQIIYRPLKTLDFPNHELEWLVRYITGSASSPSLSIWRRKKEM 173 M R GQ LL +AS + PLKT + G+ASSPSLSIWRRKKEM Sbjct: 1 MSRQGQKLLWQASGRML--LHSNPLKTNTR---------NVVMGAASSPSLSIWRRKKEM 49 Query: 172 GEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 G+EGL+VAKELKRLQS P RF+RF+K+HVSRLL+SDL+ VLAEFQR+ L+ LC K++ Sbjct: 50 GKEGLMVAKELKRLQSHPLRFDRFMKTHVSRLLKSDLVAVLAEFQRQNLVPLCMKLY 106 >ref|XP_008347474.1| PREDICTED: uncharacterized protein LOC103410568 [Malus domestica] Length = 234 Score = 117 bits (292), Expect = 7e-24 Identities = 73/122 (59%), Positives = 86/122 (70%), Gaps = 7/122 (5%) Frame = -3 Query: 352 MLRLGQNLLRRASHTFTEQIIYRPLKTLDFPNHEL---EWLVRYITG----SASSPSLSI 194 MLRL QNL+RR+S T T + P DF H L L RY +G SAS PSLSI Sbjct: 72 MLRLVQNLVRRSSPT-TPALSPSP-PYXDFSVHLLLQNTCLQRYFSGGSKASASRPSLSI 129 Query: 193 WRRKKEMGEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLC 14 WRRKKEMG+EGL+VAKELKRL+S P R + FI+SHVSRLL+SDL+ VLAEFQR+ +FL Sbjct: 130 WRRKKEMGKEGLMVAKELKRLRSQPLRLDHFIRSHVSRLLKSDLLAVLAEFQRQDQVFLS 189 Query: 13 TK 8 K Sbjct: 190 IK 191 >ref|XP_010045074.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X3 [Eucalyptus grandis] gi|702279382|ref|XP_010045075.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X3 [Eucalyptus grandis] Length = 249 Score = 116 bits (291), Expect = 9e-24 Identities = 62/112 (55%), Positives = 82/112 (73%) Frame = -3 Query: 337 QNLLRRASHTFTEQIIYRPLKTLDFPNHELEWLVRYITGSASSPSLSIWRRKKEMGEEGL 158 Q LR F + L +L + + + + +Y+ + SSPSLSIWRRKKE+G+EGL Sbjct: 3 QTALRNQHLLFHNNLAKHRLLSLLLLSPQTQQISQYVR-TTSSPSLSIWRRKKEIGKEGL 61 Query: 157 IVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 IVAKELKR+QS+P R +RFIKSHVSRLL+SDLI+VLAEFQR+ +FLC K++ Sbjct: 62 IVAKELKRIQSNPVRLDRFIKSHVSRLLKSDLISVLAEFQRQDQVFLCMKLY 113 >ref|XP_010045066.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X2 [Eucalyptus grandis] gi|702279347|ref|XP_010045067.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X2 [Eucalyptus grandis] gi|702279353|ref|XP_010045068.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X2 [Eucalyptus grandis] gi|702279357|ref|XP_010045069.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X2 [Eucalyptus grandis] gi|702279363|ref|XP_010045070.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X2 [Eucalyptus grandis] gi|702279367|ref|XP_010045072.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X2 [Eucalyptus grandis] gi|702279374|ref|XP_010045073.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X2 [Eucalyptus grandis] gi|629122736|gb|KCW87226.1| hypothetical protein EUGRSUZ_B03737 [Eucalyptus grandis] Length = 259 Score = 116 bits (291), Expect = 9e-24 Identities = 63/119 (52%), Positives = 85/119 (71%) Frame = -3 Query: 358 FTMLRLGQNLLRRASHTFTEQIIYRPLKTLDFPNHELEWLVRYITGSASSPSLSIWRRKK 179 F +L + LR F + L +L + + + + +Y+ + SSPSLSIWRRKK Sbjct: 6 FHLLLRRRTALRNQHLLFHNNLAKHRLLSLLLLSPQTQQISQYVR-TTSSPSLSIWRRKK 64 Query: 178 EMGEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFLCTKIH 2 E+G+EGLIVAKELKR+QS+P R +RFIKSHVSRLL+SDLI+VLAEFQR+ +FLC K++ Sbjct: 65 EIGKEGLIVAKELKRIQSNPVRLDRFIKSHVSRLLKSDLISVLAEFQRQDQVFLCMKLY 123 >ref|XP_004291779.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Fragaria vesca subsp. vesca] Length = 262 Score = 116 bits (290), Expect = 1e-23 Identities = 67/125 (53%), Positives = 86/125 (68%), Gaps = 8/125 (6%) Frame = -3 Query: 352 MLRLGQNLLRRASH---TFTEQIIYRPLKTLDFPNHELEWLVR-----YITGSASSPSLS 197 MLRL N+LRR+S + + + L FP + ++ + + ASSPSLS Sbjct: 1 MLRLASNILRRSSARTLASSRDLSLQLLLHHIFPQQQDDFWHQQRSCFFEQSKASSPSLS 60 Query: 196 IWRRKKEMGEEGLIVAKELKRLQSSPARFERFIKSHVSRLLESDLITVLAEFQRRYLIFL 17 IWRRKKEMG+EGL+VAKELKRL S P R +RFI+SHVSRLL+SDL+ VLAEFQR+ +FL Sbjct: 61 IWRRKKEMGKEGLVVAKELKRLCSHPLRLDRFIRSHVSRLLKSDLLAVLAEFQRQDQVFL 120 Query: 16 CTKIH 2 C KI+ Sbjct: 121 CMKIY 125