BLASTX nr result
ID: Cornus23_contig00038003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00038003 (312 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014235370.1| PREDICTED: 60S ribosomal protein L11 [Tricho... 114 2e-23 ref|XP_008012061.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 114 3e-23 ref|XP_005349545.1| PREDICTED: 60S ribosomal protein L11-like [M... 114 3e-23 ref|XP_005739862.1| PREDICTED: 60S ribosomal protein L11 [Pundam... 114 3e-23 ref|XP_003458587.1| PREDICTED: 60S ribosomal protein L11 [Oreoch... 114 3e-23 tpe|CAL69062.1| TPA: putative 60S ribosomal protein L11 [Spadell... 114 3e-23 ref|XP_014461199.1| PREDICTED: 60S ribosomal protein L11 isoform... 114 4e-23 ref|XP_014402400.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 114 4e-23 ref|XP_014410091.1| PREDICTED: 60S ribosomal protein L11 isoform... 114 4e-23 gb|KQL70546.1| hypothetical protein Y1Q_024796 [Alligator missis... 114 4e-23 gb|KQL70545.1| hypothetical protein Y1Q_024796 [Alligator missis... 114 4e-23 ref|XP_014315793.1| PREDICTED: 60S ribosomal protein L11 isoform... 114 4e-23 ref|XP_014315792.1| PREDICTED: 60S ribosomal protein L11 isoform... 114 4e-23 ref|XP_013879929.1| PREDICTED: 60S ribosomal protein L11 [Austro... 114 4e-23 ref|XP_013926814.1| PREDICTED: 60S ribosomal protein L11 [Thamno... 114 4e-23 ref|XP_013829836.1| PREDICTED: 60S ribosomal protein L11 isoform... 114 4e-23 ref|NP_001125385.1| 60S ribosomal protein L11 [Pongo abelii] gi|... 114 4e-23 ref|XP_003968865.1| PREDICTED: 60S ribosomal protein L11 isoform... 114 4e-23 ref|NP_001001638.1| 60S ribosomal protein L11 [Sus scrofa] gi|51... 114 4e-23 ref|NP_080195.1| 60S ribosomal protein L11 [Mus musculus] gi|154... 114 4e-23 >ref|XP_014235370.1| PREDICTED: 60S ribosomal protein L11 [Trichogramma pretiosum] Length = 186 Score = 114 bits (286), Expect = 2e-23 Identities = 57/66 (86%), Positives = 62/66 (93%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 +NPMR++KI KLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSKARYTVR+FGIRRNEKI Sbjct: 16 KNPMREVKIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKI 75 Query: 13 S--CSV 2 S C+V Sbjct: 76 SVHCTV 81 >ref|XP_008012061.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L11-like [Chlorocebus sabaeus] Length = 178 Score = 114 bits (285), Expect = 3e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMRK++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKA+YTVR+FGIRRNEKI Sbjct: 9 ENPMRKLRILKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKAKYTVRSFGIRRNEKI 68 Query: 13 S--CSV 2 + C+V Sbjct: 69 AVHCTV 74 >ref|XP_005349545.1| PREDICTED: 60S ribosomal protein L11-like [Microtus ochrogaster] Length = 178 Score = 114 bits (285), Expect = 3e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 9 ENPMRELRICKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query: 13 S--CSV 2 + C+V Sbjct: 69 AVHCTV 74 >ref|XP_005739862.1| PREDICTED: 60S ribosomal protein L11 [Pundamilia nyererei] Length = 192 Score = 114 bits (285), Expect = 3e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 23 ENPMREVRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 82 Query: 13 S--CSV 2 + C+V Sbjct: 83 AVHCTV 88 >ref|XP_003458587.1| PREDICTED: 60S ribosomal protein L11 [Oreochromis niloticus] gi|554861820|ref|XP_005941011.1| PREDICTED: 60S ribosomal protein L11 [Haplochromis burtoni] gi|835997320|ref|XP_004572770.2| PREDICTED: 60S ribosomal protein L11 [Maylandia zebra] Length = 178 Score = 114 bits (285), Expect = 3e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 9 ENPMREVRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query: 13 S--CSV 2 + C+V Sbjct: 69 AVHCTV 74 >tpe|CAL69062.1| TPA: putative 60S ribosomal protein L11 [Spadella cephaloptera] Length = 207 Score = 114 bits (285), Expect = 3e-23 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -3 Query: 190 NPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKIS 11 NPMR IKI KLCLNICVGESGDRLTRAAKVLEQL+GQ PVFSKARYTVR+FGIRRNEKI+ Sbjct: 19 NPMRDIKIMKLCLNICVGESGDRLTRAAKVLEQLSGQQPVFSKARYTVRSFGIRRNEKIA 78 Query: 10 C 8 C Sbjct: 79 C 79 >ref|XP_014461199.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Alligator mississippiensis] Length = 178 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query: 13 S--CSV 2 + C+V Sbjct: 69 AVHCTV 74 >ref|XP_014402400.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L11 [Myotis brandtii] Length = 178 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query: 13 S--CSV 2 + C+V Sbjct: 69 AVHCTV 74 >ref|XP_014410091.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Camelus ferus] Length = 206 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 37 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 96 Query: 13 S--CSV 2 + C+V Sbjct: 97 AVHCTV 102 >gb|KQL70546.1| hypothetical protein Y1Q_024796 [Alligator mississippiensis] Length = 717 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 548 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 607 Query: 13 S--CSV 2 + C+V Sbjct: 608 AVHCTV 613 >gb|KQL70545.1| hypothetical protein Y1Q_024796 [Alligator mississippiensis] Length = 718 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 549 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 608 Query: 13 S--CSV 2 + C+V Sbjct: 609 AVHCTV 614 >ref|XP_014315793.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Myotis lucifugus] Length = 233 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 64 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 123 Query: 13 S--CSV 2 + C+V Sbjct: 124 AVHCTV 129 >ref|XP_014315792.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Myotis lucifugus] Length = 234 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 65 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 124 Query: 13 S--CSV 2 + C+V Sbjct: 125 AVHCTV 130 >ref|XP_013879929.1| PREDICTED: 60S ribosomal protein L11 [Austrofundulus limnaeus] Length = 178 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query: 13 S--CSV 2 + C+V Sbjct: 69 AVHCTV 74 >ref|XP_013926814.1| PREDICTED: 60S ribosomal protein L11 [Thamnophis sirtalis] Length = 179 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 10 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 69 Query: 13 S--CSV 2 + C+V Sbjct: 70 AVHCTV 75 >ref|XP_013829836.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Capra hircus] Length = 218 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query: 13 S--CSV 2 + C+V Sbjct: 69 AVHCTV 74 >ref|NP_001125385.1| 60S ribosomal protein L11 [Pongo abelii] gi|75061913|sp|Q5RC11.3|RL11_PONAB RecName: Full=60S ribosomal protein L11 gi|55727893|emb|CAH90699.1| hypothetical protein [Pongo abelii] Length = 178 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query: 13 S--CSV 2 + C+V Sbjct: 69 AVHCTV 74 >ref|XP_003968865.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Takifugu rubripes] gi|47209129|emb|CAF89662.1| unnamed protein product [Tetraodon nigroviridis] Length = 178 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query: 13 S--CSV 2 + C+V Sbjct: 69 AVHCTV 74 >ref|NP_001001638.1| 60S ribosomal protein L11 [Sus scrofa] gi|51704216|sp|Q29205.3|RL11_PIG RecName: Full=60S ribosomal protein L11 gi|675970137|pdb|4W20|J Chain J, Structure Of The Mammalian 60s Ribosomal Subunit (this Entry Contains The Large Ribosomal Proteins) gi|675970187|pdb|4W22|J Chain J, Structure Of The 80s Mammalian Ribosome Bound To Eef2 (this Entry Contains The Large Ribosomal Subunit Proteins) gi|675970279|pdb|4W25|J Chain J, Structure Of The Idle Mammalian Ribosome-sec61 Complex (this Entry Contains The Large Ribosomal Subunit Proteins) gi|675970332|pdb|4W27|J Chain J, Structure Of The Translating Mammalian Ribosome-sec61 Complex (this Entry Contains The Large Ribosomal Subunit Proteins) gi|45239006|gb|AAS55632.1| ribosomal protein L11 [Sus scrofa] Length = 178 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query: 13 S--CSV 2 + C+V Sbjct: 69 AVHCTV 74 >ref|NP_080195.1| 60S ribosomal protein L11 [Mus musculus] gi|15431290|ref|NP_000966.2| 60S ribosomal protein L11 isoform 1 [Homo sapiens] gi|115497634|ref|NP_001069049.1| 60S ribosomal protein L11 [Bos taurus] gi|359806960|ref|NP_001240835.1| 60S ribosomal protein L11 isoform 1 [Canis lupus familiaris] gi|537544607|ref|NP_001269300.1| 60S ribosomal protein L11 [Chinchilla lanigera] gi|756140781|ref|NP_001291809.1| ribosomal protein L11 [Ailuropoda melanoleuca] gi|149695161|ref|XP_001504267.1| PREDICTED: 60S ribosomal protein L11 [Equus caballus] gi|332244993|ref|XP_003271647.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Nomascus leucogenys] gi|348571191|ref|XP_003471379.1| PREDICTED: 60S ribosomal protein L11 [Cavia porcellus] gi|397478973|ref|XP_003810808.1| PREDICTED: 60S ribosomal protein L11 [Pan paniscus] gi|402853372|ref|XP_003891370.1| PREDICTED: 60S ribosomal protein L11 [Papio anubis] gi|410966360|ref|XP_003989701.1| PREDICTED: 60S ribosomal protein L11 [Felis catus] gi|426328297|ref|XP_004024937.1| PREDICTED: 60S ribosomal protein L11 [Gorilla gorilla gorilla] gi|466086023|ref|XP_004285699.1| PREDICTED: 60S ribosomal protein L11 [Orcinus orca] gi|470626295|ref|XP_004320311.1| PREDICTED: 60S ribosomal protein L11 [Tursiops truncatus] gi|471378770|ref|XP_004377186.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Trichechus manatus latirostris] gi|472350260|ref|XP_004394821.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Odobenus rosmarus divergens] gi|478502936|ref|XP_004425776.1| PREDICTED: 60S ribosomal protein L11 isoform 2 [Ceratotherium simum simum] gi|507670221|ref|XP_004637663.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Octodon degus] gi|512977126|ref|XP_004850617.1| PREDICTED: 60S ribosomal protein L11 [Heterocephalus glaber] gi|544408322|ref|XP_005544522.1| PREDICTED: 60S ribosomal protein L11 [Macaca fascicularis] gi|548455540|ref|XP_005676921.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Capra hircus] gi|558148997|ref|XP_006094108.1| PREDICTED: 60S ribosomal protein L11 isoform X3 [Myotis lucifugus] gi|564353656|ref|XP_006239286.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Rattus norvegicus] gi|584080398|ref|XP_006777625.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Myotis davidii] gi|585171328|ref|XP_006737645.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Leptonychotes weddellii] gi|585650595|ref|XP_006883588.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Elephantulus edwardii] gi|593765173|ref|XP_007121151.1| PREDICTED: 60S ribosomal protein L11 [Physeter catodon] gi|594110330|ref|XP_006078005.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Bubalus bubalis] gi|594653475|ref|XP_007175168.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Balaenoptera acutorostrata scammoni] gi|602694333|ref|XP_007459239.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Lipotes vexillifer] gi|617610022|ref|XP_007524793.1| PREDICTED: 60S ribosomal protein L11 [Erinaceus europaeus] gi|635110740|ref|XP_007978264.1| PREDICTED: 60S ribosomal protein L11 [Chlorocebus sabaeus] gi|640807039|ref|XP_008059998.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Tarsius syrichta] gi|641714039|ref|XP_008146324.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Eptesicus fuscus] gi|655850868|ref|XP_008263912.1| PREDICTED: 60S ribosomal protein L11 [Oryctolagus cuniculus] gi|664723737|ref|XP_008518979.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Equus przewalskii] gi|667242501|ref|XP_008571152.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Galeopterus variegatus] gi|667242504|ref|XP_008571160.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Galeopterus variegatus] gi|674078662|ref|XP_008846816.1| PREDICTED: 60S ribosomal protein L11 [Nannospalax galili] gi|675668615|ref|XP_008998873.1| PREDICTED: 60S ribosomal protein L11 [Callithrix jacchus] gi|724959828|ref|XP_010354068.1| PREDICTED: 60S ribosomal protein L11 [Rhinopithecus roxellana] gi|731220090|ref|XP_010624280.1| PREDICTED: 60S ribosomal protein L11 [Fukomys damarensis] gi|759112645|ref|XP_011355886.1| PREDICTED: 60S ribosomal protein L11 [Pteropus vampyrus] gi|795125304|ref|XP_011833215.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Mandrillus leucophaeus] gi|795373056|ref|XP_011935575.1| PREDICTED: 60S ribosomal protein L11 [Cercocebus atys] gi|795433607|ref|XP_011761124.1| PREDICTED: 60S ribosomal protein L11 [Macaca nemestrina] gi|859757877|ref|XP_012903226.1| PREDICTED: 60S ribosomal protein L11 [Mustela putorius furo] gi|859892058|ref|XP_012900658.1| PREDICTED: 60S ribosomal protein L11 [Mustela putorius furo] gi|51701767|sp|Q6QMZ8.3|RL11_CHILA RecName: Full=60S ribosomal protein L11 gi|51702792|sp|P62914.2|RL11_RAT RecName: Full=60S ribosomal protein L11 gi|51702795|sp|P62913.2|RL11_HUMAN RecName: Full=60S ribosomal protein L11; AltName: Full=CLL-associated antigen KW-12 gi|51704334|sp|Q9CXW4.4|RL11_MOUSE RecName: Full=60S ribosomal protein L11 gi|108860925|sp|Q3T087.3|RL11_BOVIN RecName: Full=60S ribosomal protein L11 gi|187609302|pdb|2ZKR|DD Chain d, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-em Map gi|485601462|pdb|3J3B|J Chain J, Structure Of The Human 60s Ribosomal Proteins gi|665764268|pdb|4CXD|J Chain J, Regulation Of The Mammalian Elongation Cycle By 40s Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement gi|672884385|pdb|4UPX|J Chain J, Mammalian 80s Hcv-ires Initiation Complex With Eif5b Pre-like State gi|672884437|pdb|4UQ1|J Chain J, Mammalian 80s Hcv-ires Initiation Complex With Eif5b Post-like State gi|914684883|pdb|4XXB|A Chain A, Crystal Structure Of Human Mdm2-rpl11 gi|57678|emb|CAA44072.1| ribosomal protein L11 [Rattus rattus] gi|3115334|gb|AAC15856.1| ribosomal protein L11 [Homo sapiens] gi|12833384|dbj|BAB22504.1| unnamed protein product [Mus musculus] gi|12842596|dbj|BAB25660.1| unnamed protein product [Mus musculus] gi|12847187|dbj|BAB27470.1| unnamed protein product [Mus musculus] gi|12848155|dbj|BAB27850.1| unnamed protein product [Mus musculus] gi|19264021|gb|AAH25077.1| Ribosomal protein L11 [Mus musculus] gi|26354092|dbj|BAC40676.1| unnamed protein product [Mus musculus] gi|45384763|gb|AAS59424.1| ribosomal protein L11 [Chinchilla lanigera] gi|47682920|gb|AAH69896.1| Ribosomal protein L11 [Mus musculus] gi|74139399|dbj|BAE40841.1| unnamed protein product [Mus musculus] gi|74151994|dbj|BAE32034.1| unnamed protein product [Mus musculus] gi|74216782|dbj|BAE37793.1| unnamed protein product [Mus musculus] gi|74268362|gb|AAI02525.1| Ribosomal protein L11 [Bos taurus] gi|119615474|gb|EAW95068.1| ribosomal protein L11, isoform CRA_b [Homo sapiens] gi|148698005|gb|EDL29952.1| mCG5487, isoform CRA_b [Mus musculus] gi|149024299|gb|EDL80796.1| ribosomal protein L11, isoform CRA_b [Rattus norvegicus] gi|189053137|dbj|BAG34759.1| unnamed protein product [Homo sapiens] gi|208967312|dbj|BAG73670.1| ribosomal protein L11 [synthetic construct] gi|296399192|gb|ADH10373.1| ribosomal protein L11 [Ailuropoda melanoleuca] gi|296399194|gb|ADH10374.1| ribosomal protein L11 [Ailuropoda melanoleuca] gi|296489988|tpg|DAA32101.1| TPA: 60S ribosomal protein L11 [Bos taurus] Length = 178 Score = 114 bits (284), Expect = 4e-23 Identities = 56/66 (84%), Positives = 63/66 (95%), Gaps = 2/66 (3%) Frame = -3 Query: 193 ENPMRKIKIAKLCLNICVGESGDRLTRAAKVLEQLTGQSPVFSKARYTVRTFGIRRNEKI 14 ENPMR+++I KLCLNICVGESGDRLTRAAKVLEQLTGQ+PVFSKARYTVR+FGIRRNEKI Sbjct: 9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKI 68 Query: 13 S--CSV 2 + C+V Sbjct: 69 AVHCTV 74