BLASTX nr result
ID: Cornus23_contig00037992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00037992 (283 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007923321.1| hypothetical protein MYCFIDRAFT_150893 [Pseu... 67 4e-09 >ref|XP_007923321.1| hypothetical protein MYCFIDRAFT_150893 [Pseudocercospora fijiensis CIRAD86] gi|452986082|gb|EME85838.1| hypothetical protein MYCFIDRAFT_150893 [Pseudocercospora fijiensis CIRAD86] Length = 528 Score = 67.4 bits (163), Expect = 4e-09 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 2/60 (3%) Frame = -2 Query: 282 AYVVHDLPAGPHPVDLLIDSPIRMLYSTATSTDYFS--APSTSTDSGLTVLLAKLDNAAR 109 AYVV LP+GP PVDLLI+SP R+ S + + S A STS DSGL+VLLAKLDNAAR Sbjct: 461 AYVVTSLPSGPDPVDLLIESPARLPLSASANISNVSSIACSTSADSGLSVLLAKLDNAAR 520