BLASTX nr result
ID: Cornus23_contig00037627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00037627 (435 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006376430.1| hypothetical protein POPTR_0013s12970g [Popu... 58 3e-06 >ref|XP_006376430.1| hypothetical protein POPTR_0013s12970g [Populus trichocarpa] gi|118481694|gb|ABK92787.1| unknown [Populus trichocarpa] gi|118489319|gb|ABK96464.1| unknown [Populus trichocarpa x Populus deltoides] gi|550325706|gb|ERP54227.1| hypothetical protein POPTR_0013s12970g [Populus trichocarpa] Length = 126 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 433 SIFQGFVISIIFAFTASFSGVFIHKKPKIARCFLYLSMVSMVS 305 SIF FVIS++FAFT SF + I KKPK++R F YLS++SM S Sbjct: 57 SIFHAFVISVVFAFTGSFCSLMIDKKPKVSRFFAYLSVISMAS 99