BLASTX nr result
ID: Cornus23_contig00037614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00037614 (345 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104... 81 3e-13 ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240... 81 3e-13 ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583... 80 6e-13 ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997... 80 6e-13 ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763... 79 1e-12 ref|XP_011083185.1| PREDICTED: uncharacterized protein LOC105165... 79 1e-12 ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179... 79 1e-12 ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610... 79 1e-12 ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 79 1e-12 ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595... 78 3e-12 ref|XP_009403897.1| PREDICTED: uncharacterized protein LOC103987... 78 3e-12 ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247... 77 4e-12 ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973... 77 5e-12 ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669... 77 5e-12 ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968... 77 7e-12 ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 77 7e-12 ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128... 76 9e-12 ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 76 1e-11 ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703... 75 1e-11 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 75 1e-11 >ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104584 [Nicotiana tomentosiformis] Length = 45 Score = 81.3 bits (199), Expect = 3e-13 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -3 Query: 334 KFMSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 + MSPVISEVLLSGFTINSTL RR+HLVQSFSVVFLYWFYVFS Sbjct: 3 EIMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240532 [Nicotiana sylvestris] Length = 45 Score = 80.9 bits (198), Expect = 3e-13 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSPVISEVLLSGFTINSTL RR+HLVQSFSVVFLYWFYVFS Sbjct: 5 MSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583416 [Brachypodium distachyon] gi|944057566|gb|KQJ93156.1| hypothetical protein BRADI_3g02990 [Brachypodium distachyon] Length = 41 Score = 80.1 bits (196), Expect = 6e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSPVISE+LLSGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997494 [Musa acuminata subsp. malaccensis] Length = 41 Score = 80.1 bits (196), Expect = 6e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSP++SE+LLSGF INSTLRRRSHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763252 [Gossypium raimondii] Length = 41 Score = 79.3 bits (194), Expect = 1e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSPV+SE+LLSGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_011083185.1| PREDICTED: uncharacterized protein LOC105165758 [Sesamum indicum] Length = 43 Score = 79.3 bits (194), Expect = 1e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MS V+SE+LLSGFT+NSTLRRRSHLVQSFSVVFLYWFYVFS Sbjct: 3 MSAVLSEILLSGFTVNSTLRRRSHLVQSFSVVFLYWFYVFS 43 >ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179060 [Sesamum indicum] Length = 41 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSPV+SE+LLSGFT+NS+L RRSHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFTVNSSLHRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610579 [Nelumbo nucifera] Length = 41 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSP++SE+LLSGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] gi|723672381|ref|XP_010316390.1| PREDICTED: uncharacterized protein LOC104645744 [Solanum lycopersicum] Length = 41 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 M+PVISEVLLSGFTINSTLRR +HLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595623 [Nelumbo nucifera] Length = 41 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSP++SE+LLSGF INS+LRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPIVSEILLSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009403897.1| PREDICTED: uncharacterized protein LOC103987344 [Musa acuminata subsp. malaccensis] Length = 41 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 M+P++SE+LLSGFTINSTLRRR+HLVQS SVVFLYWFYVFS Sbjct: 1 MTPILSEILLSGFTINSTLRRRTHLVQSLSVVFLYWFYVFS 41 >ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247207 [Vitis vinifera] Length = 41 Score = 77.4 bits (189), Expect = 4e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSPV+SEVL SGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEVLRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973592 [Musa acuminata subsp. malaccensis] Length = 41 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSPV+SE+L SGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669679 [Glycine max] gi|593792796|ref|XP_007159437.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] gi|561032852|gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] gi|947110612|gb|KRH58938.1| hypothetical protein GLYMA_05G157100 [Glycine max] Length = 42 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -3 Query: 325 SPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 SPVISE+LLSGFTINS+LRRR+HLVQSFSVVFL+WFYVFS Sbjct: 3 SPVISEILLSGFTINSSLRRRTHLVQSFSVVFLHWFYVFS 42 >ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968797 [Musa acuminata subsp. malaccensis] Length = 41 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSP++SE+LL GF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLLGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -3 Query: 331 FMSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 FMSPVISE+L SG TI+S+LRRR+HLVQSFSVVFLYWFYVFS Sbjct: 12 FMSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 53 >ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128494 [Populus euphratica] Length = 41 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 M+PV+ E+LLSGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVLCEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] gi|590593628|ref|XP_007017623.1| Peptide upstream open reading frame 5 [Theobroma cacao] gi|508722951|gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSPV+SE+L SGF INS+LRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703760 [Phoenix dactylifera] gi|672144149|ref|XP_008795970.1| PREDICTED: uncharacterized protein LOC103711555 [Phoenix dactylifera] Length = 41 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSP++SE+LLSGF I+S+LRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMISSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|593795374|ref|XP_007160725.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gi|731312172|ref|XP_010672909.1| PREDICTED: uncharacterized protein LOC104889396 [Beta vulgaris subsp. vulgaris] gi|747073329|ref|XP_011083620.1| PREDICTED: uncharacterized protein LOC105166091 [Sesamum indicum] gi|802595010|ref|XP_012071924.1| PREDICTED: uncharacterized protein LOC105633842 [Jatropha curcas] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gi|870869972|gb|KMT20717.1| hypothetical protein BVRB_1g006920 [Beta vulgaris subsp. vulgaris] gi|947066007|gb|KRH15150.1| hypothetical protein GLYMA_14G071500 [Glycine max] Length = 41 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 328 MSPVISEVLLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 206 MSPV+SE+L SGF INS+LRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41