BLASTX nr result
ID: Cornus23_contig00037501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00037501 (594 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003836896.1| hypothetical protein LEMA_P044320.1 [Leptosp... 67 9e-09 ref|XP_001936361.1| predicted protein [Pyrenophora tritici-repen... 63 1e-07 ref|XP_003299665.1| hypothetical protein PTT_10707 [Pyrenophora ... 61 4e-07 gb|KNG50241.1| anthranilate synthase component i [Stemphylium ly... 60 8e-07 gb|KEQ83560.1| hypothetical protein M438DRAFT_346502 [Aureobasid... 60 1e-06 ref|XP_007694671.1| hypothetical protein COCSADRAFT_195142 [Bipo... 58 4e-06 >ref|XP_003836896.1| hypothetical protein LEMA_P044320.1 [Leptosphaeria maculans JN3] gi|312213449|emb|CBX93531.1| hypothetical protein LEMA_P044320.1 [Leptosphaeria maculans JN3] Length = 367 Score = 66.6 bits (161), Expect = 9e-09 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 592 IARTEFQCATGDVNCFCTQSNWAYGVRDCTSQACG 488 IA TEF C GD+ CFC QSNWAYGVRDC++QACG Sbjct: 170 IANTEFSCGAGDLACFCNQSNWAYGVRDCSAQACG 204 >ref|XP_001936361.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983460|gb|EDU48948.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 238 Score = 62.8 bits (151), Expect = 1e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 592 IARTEFQCATGDVNCFCTQSNWAYGVRDCTSQAC 491 IA+TEF CA+ D+ CFCT+SNWAYG+RDC+ QAC Sbjct: 37 IAQTEFSCASDDLACFCTKSNWAYGIRDCSLQAC 70 >ref|XP_003299665.1| hypothetical protein PTT_10707 [Pyrenophora teres f. teres 0-1] gi|311326588|gb|EFQ92262.1| hypothetical protein PTT_10707 [Pyrenophora teres f. teres 0-1] Length = 241 Score = 61.2 bits (147), Expect = 4e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 592 IARTEFQCATGDVNCFCTQSNWAYGVRDCTSQAC 491 IA++EF CA+ D+ CFCT+SNWAYG+RDC+ QAC Sbjct: 37 IAQSEFSCASDDLACFCTKSNWAYGIRDCSLQAC 70 >gb|KNG50241.1| anthranilate synthase component i [Stemphylium lycopersici] Length = 759 Score = 60.1 bits (144), Expect = 8e-07 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -3 Query: 592 IARTEFQCATGDVNCFCTQSNWAYGVRDCTSQAC 491 IA +EFQC D+ CFCT+SNWA+G+RDCT +AC Sbjct: 554 IAESEFQCDDSDIACFCTRSNWAFGIRDCTREAC 587 >gb|KEQ83560.1| hypothetical protein M438DRAFT_346502 [Aureobasidium pullulans EXF-150] Length = 375 Score = 59.7 bits (143), Expect = 1e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = -3 Query: 592 IARTEFQCATGDVNCFCTQSNWAYGVRDCTSQACG 488 IA+T+F CATGDV+C+C +N+ YGVRDC ++ACG Sbjct: 35 IAQTQFGCATGDVSCYCNHANFGYGVRDCANEACG 69 >ref|XP_007694671.1| hypothetical protein COCSADRAFT_195142 [Bipolaris sorokiniana ND90Pr] gi|451856015|gb|EMD69306.1| hypothetical protein COCSADRAFT_195142 [Bipolaris sorokiniana ND90Pr] Length = 251 Score = 57.8 bits (138), Expect = 4e-06 Identities = 20/34 (58%), Positives = 29/34 (85%) Frame = -3 Query: 592 IARTEFQCATGDVNCFCTQSNWAYGVRDCTSQAC 491 IA++EF C + D+ CFC++SNWA+G+RDC+ QAC Sbjct: 36 IAQSEFSCGSDDIACFCSRSNWAFGIRDCSRQAC 69