BLASTX nr result
ID: Cornus23_contig00037053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00037053 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP90852.1| Protein Bm31 [Brugia malayi] 58 2e-06 ref|XP_001892466.1| hypothetical protein Bm1_04940 [Brugia malayi] 58 2e-06 gb|KFD59709.1| hypothetical protein M514_28109 [Trichuris suis] 56 9e-06 ref|XP_003367749.1| hypothetical protein Tsp_14606 [Trichinella ... 56 9e-06 >emb|CDP90852.1| Protein Bm31 [Brugia malayi] Length = 70 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 105 IESGCLRVQPKAAGRLLLRLNTTVRPIVNKYREGK 1 +ESGCLR+QPK G+ LRLNTT+RPI NKYREGK Sbjct: 24 LESGCLRLQPKEGGKPHLRLNTTMRPIANKYREGK 58 >ref|XP_001892466.1| hypothetical protein Bm1_04940 [Brugia malayi] Length = 65 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 105 IESGCLRVQPKAAGRLLLRLNTTVRPIVNKYREGK 1 +ESGCLR+QPK G+ LRLNTT+RPI NKYREGK Sbjct: 19 LESGCLRLQPKEGGKPHLRLNTTMRPIANKYREGK 53 >gb|KFD59709.1| hypothetical protein M514_28109 [Trichuris suis] Length = 130 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 105 IESGCLRVQPKAAGRLLLRLNTTVRPIVNKYREGK 1 ++SGC RVQPKA G+ L LNTT RPI NKYREGK Sbjct: 84 VDSGCSRVQPKAGGKSHLNLNTTTRPIANKYREGK 118 >ref|XP_003367749.1| hypothetical protein Tsp_14606 [Trichinella spiralis] gi|316954247|gb|EFV46212.1| hypothetical protein Tsp_14606 [Trichinella spiralis] Length = 114 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 132 IITISSSCMIESGCLRVQPKAAGRLLLRLNTTVRPIVNKYREGK 1 ++ + S +IESGCLR+QPKA G+ RLN RPI NKYREGK Sbjct: 43 VLCMVSRLLIESGCLRLQPKAGGKSHPRLNIRTRPIANKYREGK 86