BLASTX nr result
ID: Cornus23_contig00037008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00037008 (362 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ36007.1| putative mitochondrial import receptor subunit [E... 70 6e-10 gb|EPQ65641.1| hypothetical protein BGT96224_4585 [Blumeria gram... 66 1e-08 emb|CCU81830.1| Metaxin-like protein [Blumeria graminis f. sp. h... 65 2e-08 >gb|KHJ36007.1| putative mitochondrial import receptor subunit [Erysiphe necator] Length = 423 Score = 70.1 bits (170), Expect = 6e-10 Identities = 39/92 (42%), Positives = 56/92 (60%) Frame = -1 Query: 362 RRKCPRLSAWIQELRTEIFGGAISTLDVFVDEGSRTDIAHHLPWRKPDSLSRWDYLQISL 183 R+K PRLSAW QELRTEIFGGA+ DVF D + D LPW+K ++ + W Q+ Sbjct: 263 RQKFPRLSAWTQELRTEIFGGAVGCQDVFSDR-KKGDWGDRLPWQKSETENIWSRGQVFF 321 Query: 182 SSLIECLPGDLAQWRKTEKMKLHSYRTQKTQN 87 ++ + L G + R+ +KM+ SY +K+ N Sbjct: 322 LTMFDDLKG-FGRLRRKDKMR--SYTAKKSDN 350 >gb|EPQ65641.1| hypothetical protein BGT96224_4585 [Blumeria graminis f. sp. tritici 96224] Length = 403 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/68 (48%), Positives = 44/68 (64%) Frame = -1 Query: 362 RRKCPRLSAWIQELRTEIFGGAISTLDVFVDEGSRTDIAHHLPWRKPDSLSRWDYLQISL 183 R+K PRL+AW QELRTEIFGGA+ DV+ E + + LPWRKP++ S W + Sbjct: 259 RQKFPRLAAWTQELRTEIFGGAVGIGDVY-GERKLSQASERLPWRKPETYSIWRISSSLV 317 Query: 182 SSLIECLP 159 S++IE P Sbjct: 318 STIIEGYP 325 >emb|CCU81830.1| Metaxin-like protein [Blumeria graminis f. sp. hordei DH14] Length = 403 Score = 65.1 bits (157), Expect = 2e-08 Identities = 37/80 (46%), Positives = 50/80 (62%) Frame = -1 Query: 362 RRKCPRLSAWIQELRTEIFGGAISTLDVFVDEGSRTDIAHHLPWRKPDSLSRWDYLQISL 183 R+K PRL+AW QELRTEIFGGAI DV+ E + + LPWRKP++ S W + Sbjct: 259 RQKFPRLAAWTQELRTEIFGGAIGIGDVY-GERRLSQASERLPWRKPETNSIWRISTNLI 317 Query: 182 SSLIECLPGDLAQWRKTEKM 123 S++IE P LA + +K+ Sbjct: 318 STIIEGYP-SLAPLKARDKI 336