BLASTX nr result
ID: Cornus23_contig00036991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00036991 (298 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU76961.1| long chain fatty acyl-CoA synthetase [Blumeria g... 81 3e-13 gb|EPQ66936.1| Long chain fatty acyl-CoA synthetase [Blumeria gr... 80 6e-13 gb|KHJ34223.1| putative long-chain-fatty-acid- ligase 1 protein ... 78 2e-12 emb|CRG91424.1| long-chain acyl-CoA synthetase [Talaromyces isla... 65 2e-08 gb|KIN08217.1| hypothetical protein OIDMADRAFT_187457 [Oidiodend... 64 4e-08 emb|CCE35025.1| related to long-chain-fatty-acid--CoA ligase [Cl... 59 2e-06 gb|KJZ71152.1| hypothetical protein HIM_09451 [Hirsutella minnes... 58 3e-06 ref|XP_007289597.1| acyl-CoA synthetase [Marssonina brunnea f. s... 58 3e-06 ref|XP_007738704.1| long-chain acyl-CoA synthetase [Capronia epi... 57 4e-06 emb|CCD52948.1| similar to long-chain-fatty-acid-CoA ligase [Bot... 57 5e-06 ref|XP_001545851.1| acyl-CoA synthetase [Botrytis cinerea B05.10] 57 5e-06 ref|XP_008081603.1| Acetyl-CoA synthetase-like protein [Glarea l... 56 9e-06 gb|EHK97372.1| putative Long-chain-fatty-acid--CoA ligase 1 [Gla... 56 9e-06 ref|XP_003664027.1| hypothetical protein MYCTH_2306357 [Myceliop... 56 9e-06 ref|XP_001589310.1| hypothetical protein SS1G_09944 [Sclerotinia... 56 9e-06 >emb|CCU76961.1| long chain fatty acyl-CoA synthetase [Blumeria graminis f. sp. hordei DH14] Length = 696 Score = 81.3 bits (199), Expect = 3e-13 Identities = 34/49 (69%), Positives = 44/49 (89%) Frame = -2 Query: 147 TLLPKIAKDHIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDVS 1 ++LPKI+KDHIPPF+V+VP Y A+DGETIPRRNPN IDKL ERP++ ++ Sbjct: 5 SVLPKISKDHIPPFSVDVPGYAAIDGETIPRRNPNCIDKLRERPAEHIT 53 >gb|EPQ66936.1| Long chain fatty acyl-CoA synthetase [Blumeria graminis f. sp. tritici 96224] Length = 696 Score = 80.1 bits (196), Expect = 6e-13 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -2 Query: 138 PKIAKDHIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDVS 1 PKI+KDHIPPF+VEVP Y A+DGETIPRRNPN IDKL ERP++ ++ Sbjct: 8 PKISKDHIPPFSVEVPGYAAIDGETIPRRNPNCIDKLRERPAEHIT 53 >gb|KHJ34223.1| putative long-chain-fatty-acid- ligase 1 protein [Erysiphe necator] Length = 697 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/47 (70%), Positives = 41/47 (87%) Frame = -2 Query: 144 LLPKIAKDHIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDV 4 L P+IAKD IPPF+VE+PNYKAV+GETIPRRNP IDKL++RP + + Sbjct: 6 LQPRIAKDRIPPFSVEIPNYKAVEGETIPRRNPRCIDKLIDRPDEGI 52 >emb|CRG91424.1| long-chain acyl-CoA synthetase [Talaromyces islandicus] Length = 692 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = -2 Query: 159 AMSTTLLPKIAKDHIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDVS 1 A TTL P++AK PPF VE Y+ VDGETIPRRNP A DKL+ RP+DDV+ Sbjct: 2 ASLTTLQPRMAKR--PPFTVEASGYEPVDGETIPRRNPAAKDKLITRPADDVA 52 >gb|KIN08217.1| hypothetical protein OIDMADRAFT_187457 [Oidiodendron maius Zn] Length = 697 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/51 (54%), Positives = 41/51 (80%) Frame = -2 Query: 153 STTLLPKIAKDHIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDVS 1 + L PKI+ H PPF++EVP VDGETIPRRNP+A++KL++RPS++++ Sbjct: 6 TAVLQPKIS--HAPPFSLEVPGAPQVDGETIPRRNPHAVNKLIDRPSEEIA 54 >emb|CCE35025.1| related to long-chain-fatty-acid--CoA ligase [Claviceps purpurea 20.1] Length = 798 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/68 (44%), Positives = 41/68 (60%) Frame = -2 Query: 204 PQSIE*SALHLPTNFAMSTTLLPKIAKDHIPPFNVEVPNYKAVDGETIPRRNPNAIDKLL 25 P I + H T++ TT L + H P+++E P YK + GETIPRR+P A + LL Sbjct: 94 PPPITTAPQHTMTDYTTGTTPLHPV---HKAPYSIEAPGYKKIPGETIPRRHPRAKNGLL 150 Query: 24 ERPSDDVS 1 RPSDDV+ Sbjct: 151 TRPSDDVN 158 >gb|KJZ71152.1| hypothetical protein HIM_09451 [Hirsutella minnesotensis 3608] Length = 692 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -2 Query: 150 TTLLPKIAKDHIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDV 4 T ++P +A+ H PPF +E P YK V GETIPRR+P A LL RP+DDV Sbjct: 5 TGIMP-LAQVHKPPFTIESPGYKPVPGETIPRRHPRAKGGLLNRPADDV 52 >ref|XP_007289597.1| acyl-CoA synthetase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866717|gb|EKD19756.1| acyl-CoA synthetase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 696 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 114 PPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDVS 1 PPF+VE P Y+A GET+PRR+P A DKLLERP +D++ Sbjct: 16 PPFSVEAPGYEATKGETLPRRHPKAKDKLLERPIEDIA 53 >ref|XP_007738704.1| long-chain acyl-CoA synthetase [Capronia epimyces CBS 606.96] gi|590002047|gb|EXJ77266.1| long-chain acyl-CoA synthetase [Capronia epimyces CBS 606.96] Length = 700 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 114 PPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDVS 1 PPF+VEVP Y+ +GETIPRRNP A DKL+ PSDDV+ Sbjct: 23 PPFSVEVPGYEKKEGETIPRRNPLAKDKLITIPSDDVT 60 >emb|CCD52948.1| similar to long-chain-fatty-acid-CoA ligase [Botrytis cinerea T4] gi|472240934|gb|EMR85680.1| putative long-chain-fatty-acid- ligase 1 protein [Botrytis cinerea BcDW1] Length = 700 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 120 HIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDVS 1 H PPF+ E P +KAV+GETIPRR+P +KL RPS+DVS Sbjct: 18 HSPPFSAEAPGHKAVNGETIPRRHPLTANKLATRPSEDVS 57 >ref|XP_001545851.1| acyl-CoA synthetase [Botrytis cinerea B05.10] Length = 700 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 120 HIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDVS 1 H PPF+ E P +KAV+GETIPRR+P +KL RPS+DVS Sbjct: 18 HSPPFSAEAPGHKAVNGETIPRRHPLTANKLATRPSEDVS 57 >ref|XP_008081603.1| Acetyl-CoA synthetase-like protein [Glarea lozoyensis ATCC 20868] gi|512202501|gb|EPE31328.1| Acetyl-CoA synthetase-like protein [Glarea lozoyensis ATCC 20868] Length = 696 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = -2 Query: 147 TLLPKIAKDHIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDV 4 T+ PK+ K PPF++EVP + V+GETIPRR+P AI+ L++ PS+DV Sbjct: 7 TVQPKLVKK--PPFSLEVPGVQKVEGETIPRRHPQAINGLIDTPSEDV 52 >gb|EHK97372.1| putative Long-chain-fatty-acid--CoA ligase 1 [Glarea lozoyensis 74030] Length = 638 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = -2 Query: 147 TLLPKIAKDHIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDV 4 T+ PK+ K PPF++EVP + V+GETIPRR+P AI+ L++ PS+DV Sbjct: 7 TVQPKLVKK--PPFSLEVPGVQKVEGETIPRRHPQAINGLIDTPSEDV 52 >ref|XP_003664027.1| hypothetical protein MYCTH_2306357 [Myceliophthora thermophila ATCC 42464] gi|347011297|gb|AEO58782.1| hypothetical protein MYCTH_2306357 [Myceliophthora thermophila ATCC 42464] Length = 696 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/58 (46%), Positives = 39/58 (67%) Frame = -2 Query: 174 LPTNFAMSTTLLPKIAKDHIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDVS 1 +P ++ + T L K+ K PP+ +E P Y+ VDGETIPRR+P A D L+ERP+ V+ Sbjct: 1 MPFTYSAAQTPLYKVQK---PPYTIESPGYQPVDGETIPRRHPKAKDGLVERPAPGVN 55 >ref|XP_001589310.1| hypothetical protein SS1G_09944 [Sclerotinia sclerotiorum 1980] gi|154694338|gb|EDN94076.1| hypothetical protein SS1G_09944 [Sclerotinia sclerotiorum 1980 UF-70] Length = 700 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = -2 Query: 153 STTLLPKIAKDHIPPFNVEVPNYKAVDGETIPRRNPNAIDKLLERPSDDVS 1 + T+ PK H PPF+ + P YK V GETIPRR+P +KL RPS+DVS Sbjct: 9 NATVQPKFY--HSPPFSTDAPGYKPVQGETIPRRHPLTANKLATRPSEDVS 57