BLASTX nr result
ID: Cornus23_contig00036672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00036672 (276 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA21623.1| hypothetical protein SOVF_041500 [Spinacia oleracea] 98 2e-18 ref|XP_010681700.1| PREDICTED: ATP synthase subunit beta, mitoch... 98 2e-18 ref|XP_008243316.1| PREDICTED: ATP synthase subunit beta, mitoch... 98 2e-18 ref|XP_008240303.1| PREDICTED: ATP synthase subunit beta, mitoch... 98 2e-18 ref|XP_008240193.1| PREDICTED: ATP synthase subunit beta, mitoch... 98 2e-18 emb|CBI26938.3| unnamed protein product [Vitis vinifera] 98 2e-18 emb|CBI15526.3| unnamed protein product [Vitis vinifera] 98 2e-18 ref|XP_002280824.1| PREDICTED: ATP synthase subunit beta, mitoch... 98 2e-18 ref|XP_002283951.1| PREDICTED: ATP synthase subunit beta, mitoch... 98 2e-18 ref|XP_012833351.1| PREDICTED: ATP synthase subunit beta, mitoch... 98 2e-18 ref|XP_004299555.1| PREDICTED: ATP synthase subunit beta, mitoch... 98 2e-18 emb|CAN69512.1| hypothetical protein VITISV_018718 [Vitis vinifera] 98 2e-18 sp|P17614.1|ATPBM_NICPL RecName: Full=ATP synthase subunit beta,... 98 3e-18 ref|XP_009596479.1| PREDICTED: ATP synthase subunit beta, mitoch... 98 3e-18 ref|XP_009613485.1| PREDICTED: ATP synthase subunit beta, mitoch... 98 3e-18 ref|NP_001289494.1| ATP synthase subunit beta, mitochondrial-lik... 98 3e-18 ref|NP_001289540.1| ATP synthase subunit beta, mitochondrial [Ni... 98 3e-18 gb|AAD03393.1| ATPase beta subunit [Nicotiana sylvestris] 98 3e-18 gb|AHM22924.1| ATP synthase subunit beta [Nicotiana tabacum] 98 3e-18 ref|XP_006360427.1| PREDICTED: ATP synthase subunit beta, mitoch... 98 3e-18 >gb|KNA21623.1| hypothetical protein SOVF_041500 [Spinacia oleracea] Length = 553 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 491 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 537 >ref|XP_010681700.1| PREDICTED: ATP synthase subunit beta, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870856546|gb|KMT08173.1| hypothetical protein BVRB_6g142960 [Beta vulgaris subsp. vulgaris] Length = 552 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 490 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 536 >ref|XP_008243316.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Prunus mume] Length = 560 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 497 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 543 >ref|XP_008240303.1| PREDICTED: ATP synthase subunit beta, mitochondrial [Prunus mume] Length = 425 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 362 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 408 >ref|XP_008240193.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Prunus mume] Length = 549 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 486 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 532 >emb|CBI26938.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 356 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 402 >emb|CBI15526.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 356 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 402 >ref|XP_002280824.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Vitis vinifera] Length = 554 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 491 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 537 >ref|XP_002283951.1| PREDICTED: ATP synthase subunit beta, mitochondrial [Vitis vinifera] Length = 557 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 494 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 540 >ref|XP_012833351.1| PREDICTED: ATP synthase subunit beta, mitochondrial [Erythranthe guttatus] gi|604341523|gb|EYU40797.1| hypothetical protein MIMGU_mgv1a003950mg [Erythranthe guttata] Length = 553 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 490 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 536 >ref|XP_004299555.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 551 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 489 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 535 >emb|CAN69512.1| hypothetical protein VITISV_018718 [Vitis vinifera] Length = 560 Score = 98.2 bits (243), Expect = 2e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYV+LKESITSFQGVLDGKYDDLSEQSFYMVGG Sbjct: 497 QPFHVAEVFTGAPGKYVELKESITSFQGVLDGKYDDLSEQSFYMVGG 543 >sp|P17614.1|ATPBM_NICPL RecName: Full=ATP synthase subunit beta, mitochondrial; Flags: Precursor gi|19685|emb|CAA26620.1| ATP synthase beta subunit [Nicotiana plumbaginifolia] Length = 560 Score = 97.8 bits (242), Expect = 3e-18 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYVDLKESI SFQGVLDGKYDDLSEQSFYMVGG Sbjct: 497 QPFHVAEVFTGAPGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 543 >ref|XP_009596479.1| PREDICTED: ATP synthase subunit beta, mitochondrial [Nicotiana tomentosiformis] Length = 560 Score = 97.8 bits (242), Expect = 3e-18 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYVDLKESI SFQGVLDGKYDDLSEQSFYMVGG Sbjct: 497 QPFHVAEVFTGAPGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 543 >ref|XP_009613485.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Nicotiana tomentosiformis] Length = 556 Score = 97.8 bits (242), Expect = 3e-18 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYVDLKESI SFQGVLDGKYDDLSEQSFYMVGG Sbjct: 493 QPFHVAEVFTGAPGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 539 >ref|NP_001289494.1| ATP synthase subunit beta, mitochondrial-like [Nicotiana sylvestris] gi|3676296|gb|AAD03392.1| mitochondrial ATPase beta subunit [Nicotiana sylvestris] Length = 556 Score = 97.8 bits (242), Expect = 3e-18 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYVDLKESI SFQGVLDGKYDDLSEQSFYMVGG Sbjct: 493 QPFHVAEVFTGAPGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 539 >ref|NP_001289540.1| ATP synthase subunit beta, mitochondrial [Nicotiana sylvestris] gi|3676294|gb|AAD03391.1| mitochondrial ATPase beta subunit [Nicotiana sylvestris] Length = 561 Score = 97.8 bits (242), Expect = 3e-18 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYVDLKESI SFQGVLDGKYDDLSEQSFYMVGG Sbjct: 498 QPFHVAEVFTGAPGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 544 >gb|AAD03393.1| ATPase beta subunit [Nicotiana sylvestris] Length = 555 Score = 97.8 bits (242), Expect = 3e-18 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYVDLKESI SFQGVLDGKYDDLSEQSFYMVGG Sbjct: 492 QPFHVAEVFTGAPGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 538 >gb|AHM22924.1| ATP synthase subunit beta [Nicotiana tabacum] Length = 560 Score = 97.8 bits (242), Expect = 3e-18 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYVDLKESI SFQGVLDGKYDDLSEQSFYMVGG Sbjct: 497 QPFHVAEVFTGAPGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 543 >ref|XP_006360427.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Solanum tuberosum] Length = 562 Score = 97.8 bits (242), Expect = 3e-18 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = -3 Query: 274 QPFHVAEVFTGAPGKYVDLKESITSFQGVLDGKYDDLSEQSFYMVGG 134 QPFHVAEVFTGAPGKYVDLKESI SFQGVLDGKYDDLSEQSFYMVGG Sbjct: 499 QPFHVAEVFTGAPGKYVDLKESINSFQGVLDGKYDDLSEQSFYMVGG 545