BLASTX nr result
ID: Cornus23_contig00036564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00036564 (356 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB65648.1| hypothetical protein B456_010G104800, partial [Go... 57 4e-06 >gb|KJB65648.1| hypothetical protein B456_010G104800, partial [Gossypium raimondii] Length = 620 Score = 57.4 bits (137), Expect = 4e-06 Identities = 39/103 (37%), Positives = 52/103 (50%) Frame = +3 Query: 33 PIFTPHEIPKKHLKNLPTSKILDTINQKLSQISATTSGGYIPETPQNEPLTPDLSLKPLT 212 PIFTP+EIPK K+ + L I +L+ + + S P+TP + S+ L Sbjct: 31 PIFTPYEIPKTFQKS--QNDFLTEIQNRLNALESYKSELIAPDTP----IQAQYSVNTLY 84 Query: 213 QELSSTDEVSSDDPSQVNKITSNFPLRNYYPKPTFPDL*TEER 341 Q SS E D Q+NK+ P R YYPK T PDL EE+ Sbjct: 85 Q--SSQSESDQSDEQQINKMAWKEPKRLYYPKITAPDLNIEEK 125