BLASTX nr result
ID: Cornus23_contig00036536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00036536 (490 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM88301.1| hypothetical protein ANO11243_063340 [fungal sp.... 59 2e-06 >dbj|GAM88301.1| hypothetical protein ANO11243_063340 [fungal sp. No.11243] Length = 186 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/62 (41%), Positives = 44/62 (70%) Frame = -1 Query: 490 LECRYSADENTTRMMTLKRKYQAVSERNDELEGVLNLLRDGPMSEASTLLDQLRAGMNIS 311 L+C+Y A+ ++TR+ LKR+++A+ RN+ LE +L LLRD +AS LD++RAG++ Sbjct: 52 LKCQYVAEPDSTRLAALKRRHEALLSRNNTLESLLGLLRDASSLDASEALDRIRAGISAE 111 Query: 310 QL 305 + Sbjct: 112 DI 113