BLASTX nr result
ID: Cornus23_contig00036459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00036459 (372 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007926524.1| hypothetical protein MYCFIDRAFT_203558 [Pseu... 62 2e-07 gb|EME46463.1| hypothetical protein DOTSEDRAFT_70460 [Dothistrom... 60 6e-07 >ref|XP_007926524.1| hypothetical protein MYCFIDRAFT_203558 [Pseudocercospora fijiensis CIRAD86] gi|452983476|gb|EME83234.1| hypothetical protein MYCFIDRAFT_203558 [Pseudocercospora fijiensis CIRAD86] Length = 488 Score = 62.0 bits (149), Expect = 2e-07 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 9/63 (14%) Frame = -3 Query: 322 KATQITVGGNKDKGRFPVKQ------SATST---PAVPSALVETATVSDEEEEHARARRS 170 KA +T+G +K KGRFPV + +ATST P V S LV+TAT SD+E+EHARAR+S Sbjct: 322 KAKPVTIGSSKGKGRFPVSRQPSDASTATSTSTKPVVSSPLVQTATESDDEDEHARARKS 381 Query: 169 LVK 161 +++ Sbjct: 382 MIR 384 >gb|EME46463.1| hypothetical protein DOTSEDRAFT_70460 [Dothistroma septosporum NZE10] Length = 474 Score = 60.1 bits (144), Expect = 6e-07 Identities = 35/63 (55%), Positives = 41/63 (65%), Gaps = 9/63 (14%) Frame = -3 Query: 322 KATQITVGGNKDKGRFPVKQ---------SATSTPAVPSALVETATVSDEEEEHARARRS 170 KAT I VG K KGRFP+ + SA PAVPS LVET T S++EEEH RARRS Sbjct: 317 KATPIVVG--KSKGRFPIARQNSDSSSTPSARHVPAVPSPLVETLTESEDEEEHTRARRS 374 Query: 169 LVK 161 L++ Sbjct: 375 LIQ 377