BLASTX nr result
ID: Cornus23_contig00036336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00036336 (324 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010106013.1| hypothetical protein L484_021190 [Morus nota... 57 5e-06 ref|XP_012845854.1| PREDICTED: FK506-binding protein 5 [Erythran... 56 9e-06 gb|EYU45134.1| hypothetical protein MIMGU_mgv1a001679mg [Erythra... 56 9e-06 >ref|XP_010106013.1| hypothetical protein L484_021190 [Morus notabilis] gi|587919829|gb|EXC07283.1| hypothetical protein L484_021190 [Morus notabilis] Length = 748 Score = 57.0 bits (136), Expect = 5e-06 Identities = 36/101 (35%), Positives = 55/101 (54%), Gaps = 8/101 (7%) Frame = -2 Query: 281 GFDGLFYDEDRKKTNRALDFDDMVDGFDGKDLDESEGMNEKIVDLKK*RAEKKQ-----L 117 GF G ++D RALDF+ + + D D S+ + E+ D+ EKK+ L Sbjct: 87 GFPGFDGEKDGSGAKRALDFEALGEEADENGEDRSKEIREESADVSMGEFEKKRRSPDPL 146 Query: 116 NEYGSNEKKRVESVD---DDTKTKRSGSNRRREDKERRAHL 3 E N+KKR +S + DD K+K + +N+RR +KERR +L Sbjct: 147 EEEKDNKKKRKKSTEGSGDDEKSKDTSANKRRSEKERRDYL 187 >ref|XP_012845854.1| PREDICTED: FK506-binding protein 5 [Erythranthe guttatus] Length = 824 Score = 56.2 bits (134), Expect = 9e-06 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 4/91 (4%) Frame = -2 Query: 263 YDEDRKKTNRALDFD-DMVDGFDGKD---LDESEGMNEKIVDLKK*RAEKKQLNEYGSNE 96 + E+ +KT R L+FD D+ DG D +DESEGM+ + +K + + + + Sbjct: 171 FGEEVRKTKRVLEFDADVADGVDANGTSIVDESEGMDLETEKVKIDEEDSFEETKDKKKK 230 Query: 95 KKRVESVDDDTKTKRSGSNRRREDKERRAHL 3 KK D++KTK SN+RRE+KER+A+L Sbjct: 231 KKLKGDNGDESKTKPRASNKRREEKERQAYL 261 >gb|EYU45134.1| hypothetical protein MIMGU_mgv1a001679mg [Erythranthe guttata] Length = 773 Score = 56.2 bits (134), Expect = 9e-06 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 4/91 (4%) Frame = -2 Query: 263 YDEDRKKTNRALDFD-DMVDGFDGKD---LDESEGMNEKIVDLKK*RAEKKQLNEYGSNE 96 + E+ +KT R L+FD D+ DG D +DESEGM+ + +K + + + + Sbjct: 106 FGEEVRKTKRVLEFDADVADGVDANGTSIVDESEGMDLETEKVKIDEEDSFEETKDKKKK 165 Query: 95 KKRVESVDDDTKTKRSGSNRRREDKERRAHL 3 KK D++KTK SN+RRE+KER+A+L Sbjct: 166 KKLKGDNGDESKTKPRASNKRREEKERQAYL 196