BLASTX nr result
ID: Cornus23_contig00036140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00036140 (508 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ33501.1| putative c4-dicarboxylate transporter malic acid ... 69 1e-09 emb|CCU75622.1| C4-dicarboxylate transporter/malic acid transpor... 61 3e-07 ref|XP_001596399.1| hypothetical protein SS1G_02619 [Sclerotinia... 60 5e-07 gb|EPQ61787.1| hypothetical protein BGT96224_4097 [Blumeria gram... 60 6e-07 ref|XP_001560321.1| hypothetical protein BC1G_01153 [Botrytis ci... 58 3e-06 >gb|KHJ33501.1| putative c4-dicarboxylate transporter malic acid transport protein [Erysiphe necator] Length = 414 Score = 69.3 bits (168), Expect = 1e-09 Identities = 41/77 (53%), Positives = 50/77 (64%) Frame = -2 Query: 231 EADFKTLTSQNLSPSSVGLDDQPKSSASTIREKLNPIHNDFELGDTTLKGRLKHFTFAWF 52 E D+KT +N SP D + +SS E+ + I EL TLK RLKHFTFAW+ Sbjct: 4 EGDYKTY--KNSSPRRSQSDLENQSSIEDSMEEKSKIMPIMEL---TLKERLKHFTFAWY 58 Query: 51 ASTMSTGGVAFTLSILP 1 ASTMSTGG+AFTLS+LP Sbjct: 59 ASTMSTGGIAFTLSVLP 75 >emb|CCU75622.1| C4-dicarboxylate transporter/malic acid transport protein [Blumeria graminis f. sp. hordei DH14] Length = 413 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = -2 Query: 156 SASTIREKLNPIHNDFELGDTTLKGRLKHFTFAWFASTMSTGGVAFTLSILP 1 SA+ + EK +P N TL+ RLKHFTFAW+A TMSTGGVAFTLS++P Sbjct: 24 SATMMNEK-HPEANPIPREGLTLRQRLKHFTFAWYACTMSTGGVAFTLSVIP 74 >ref|XP_001596399.1| hypothetical protein SS1G_02619 [Sclerotinia sclerotiorum 1980] gi|154700023|gb|EDN99761.1| hypothetical protein SS1G_02619 [Sclerotinia sclerotiorum 1980 UF-70] Length = 413 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/58 (53%), Positives = 37/58 (63%) Frame = -2 Query: 174 DDQPKSSASTIREKLNPIHNDFELGDTTLKGRLKHFTFAWFASTMSTGGVAFTLSILP 1 DD + + + EK PI T RLKHFT+AW+ASTMSTGGVAFTLS+LP Sbjct: 22 DDDVEHALKEMPEKEEPIQT------LTFSERLKHFTYAWYASTMSTGGVAFTLSVLP 73 >gb|EPQ61787.1| hypothetical protein BGT96224_4097 [Blumeria graminis f. sp. tritici 96224] Length = 412 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/47 (61%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -2 Query: 135 KLNPIHNDFELG--DTTLKGRLKHFTFAWFASTMSTGGVAFTLSILP 1 K+N H D + TL+ RLKHFTFAW+A TMSTGGVAFTLS++P Sbjct: 27 KMNEKHEDNSIPREGLTLRQRLKHFTFAWYACTMSTGGVAFTLSVIP 73 >ref|XP_001560321.1| hypothetical protein BC1G_01153 [Botrytis cinerea B05.10] gi|472243784|gb|EMR88423.1| putative malic acid transport protein [Botrytis cinerea BcDW1] Length = 409 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = -2 Query: 138 EKLNPIHNDFELGDTTLKGRLKHFTFAWFASTMSTGGVAFTLSILP 1 EK PI N T RL+HFT+AWFA TMSTGGVAFTLS+LP Sbjct: 30 EKEEPIQN------LTFSERLRHFTYAWFACTMSTGGVAFTLSVLP 69