BLASTX nr result
ID: Cornus23_contig00036036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00036036 (402 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIN03869.1| hypothetical protein OIDMADRAFT_158777 [Oidiodend... 62 2e-07 gb|KHJ30123.1| putative atp-dependent rna helicase ded1 [Erysiph... 60 6e-07 ref|XP_001592708.1| ATP-dependent RNA helicase DED1 [Sclerotinia... 57 5e-06 ref|XP_001550389.1| hypothetical protein BC1G_10862 [Botrytis ci... 57 5e-06 gb|ESZ99026.1| ATP-dependent RNA helicase DED1 [Sclerotinia bore... 56 9e-06 >gb|KIN03869.1| hypothetical protein OIDMADRAFT_158777 [Oidiodendron maius Zn] Length = 662 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 127 MADQLNINGLNLNGDSDEQRSYIPPHMRGKIGAPNHQ 17 MADQLN++GL+LNG EQRSYIPPHMRGK+G P+ Q Sbjct: 1 MADQLNMSGLSLNGQGPEQRSYIPPHMRGKMGGPSPQ 37 >gb|KHJ30123.1| putative atp-dependent rna helicase ded1 [Erysiphe necator] Length = 651 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -3 Query: 127 MADQLNINGLNLNGDSDEQRSYIPPHMRGKIGAPNHQSG 11 MADQLN+NGLNLN EQRSYIPPHMRGK+G N G Sbjct: 1 MADQLNMNGLNLNAGPGEQRSYIPPHMRGKMGNINLNGG 39 >ref|XP_001592708.1| ATP-dependent RNA helicase DED1 [Sclerotinia sclerotiorum 1980] gi|160380639|sp|A7EJY3.1|DED1_SCLS1 RecName: Full=ATP-dependent RNA helicase ded1 gi|154703410|gb|EDO03149.1| ATP-dependent RNA helicase DED1 [Sclerotinia sclerotiorum 1980 UF-70] Length = 678 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 127 MADQLNINGLNLNGDSDEQRSYIPPHMRGKIGAP 26 MADQLN+NGLNLNG E RSYIPPHMRGK+G P Sbjct: 1 MADQLNMNGLNLNGG--EPRSYIPPHMRGKMGGP 32 >ref|XP_001550389.1| hypothetical protein BC1G_10862 [Botrytis cinerea B05.10] gi|160380638|sp|A6SEH9.1|DED1_BOTFB RecName: Full=ATP-dependent RNA helicase ded1 gi|347841547|emb|CCD56119.1| similar to ATP-dependent RNA helicase ded1 [Botrytis cinerea T4] gi|472239001|gb|EMR83834.1| putative atp-dependent rna helicase ded1 protein [Botrytis cinerea BcDW1] Length = 683 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 127 MADQLNINGLNLNGDSDEQRSYIPPHMRGKIGAP 26 MADQLN+NGLNLNG E RSYIPPHMRGK+G P Sbjct: 1 MADQLNMNGLNLNGG--EPRSYIPPHMRGKMGGP 32 >gb|ESZ99026.1| ATP-dependent RNA helicase DED1 [Sclerotinia borealis F-4157] Length = 687 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 127 MADQLNINGLNLNGDSDEQRSYIPPHMRGKIGAP 26 MADQ+N+NGLNLNG E RSYIPPHMRGK+G P Sbjct: 1 MADQINMNGLNLNGG--EPRSYIPPHMRGKMGGP 32