BLASTX nr result
ID: Cornus23_contig00035945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00035945 (288 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_008248270.1| hypothetical protein [Limnobacter sp. MED105... 57 7e-06 >ref|WP_008248270.1| hypothetical protein [Limnobacter sp. MED105] gi|149825321|gb|EDM84532.1| hypothetical protein LMED105_03255 [Limnobacter sp. MED105] Length = 594 Score = 56.6 bits (135), Expect = 7e-06 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 2/82 (2%) Frame = -1 Query: 270 GLN--VAAQQVFRFYLEDPSSVENVRSITGLTNSESLIGFDFRPSAPANYPLYAVGRNPN 97 GLN + A +F F L P+++ + ++TGL + L+G D R PA LY RN Sbjct: 306 GLNGTLTAPTLFSFSLRTPNTISSPVAVTGLAMGDQLLGIDVR---PATGELYGFVRNGT 362 Query: 96 NAASLYTLNPDTGALTLVGALA 31 N LYT+NPDTGA TL +L+ Sbjct: 363 N-GKLYTINPDTGAATLESSLS 383