BLASTX nr result
ID: Cornus23_contig00035823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00035823 (326 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoe... 70 6e-10 ref|XP_004345357.1| hypothetical protein ACA1_355970 [Acanthamoe... 60 8e-07 >ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] gi|440800957|gb|ELR21983.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] Length = 224 Score = 70.1 bits (170), Expect = 6e-10 Identities = 34/86 (39%), Positives = 51/86 (59%) Frame = -2 Query: 268 PEKPKFPDAFSSTVEVHRWGRTRHPRQFYRWFYDTRSNADRLDGLFEYLGEYYFGELIFN 89 PEKP P AFS+ V V R + ++++RWF D + R+D L E GE F I++ Sbjct: 28 PEKPTLPPAFSAAVHVQR--NYKPYQEYFRWFRDEKLQKARVDRLAEVHGETLFHSFIYD 85 Query: 88 HNEKKEYMVFYQDNFATCFTRPINSS 11 H+E+K + VF++ ATCFT+ I + Sbjct: 86 HSEQKMFAVFFRGEVATCFTKTIRGN 111 >ref|XP_004345357.1| hypothetical protein ACA1_355970 [Acanthamoeba castellanii str. Neff] gi|440800189|gb|ELR21231.1| hypothetical protein ACA1_355970 [Acanthamoeba castellanii str. Neff] Length = 229 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/89 (29%), Positives = 52/89 (58%), Gaps = 1/89 (1%) Frame = -2 Query: 268 PEKPKFPDAFSSTVEVHRWGRTRHPR-QFYRWFYDTRSNADRLDGLFEYLGEYYFGELIF 92 P+KP++P +S+TVE W HP +F+R F+D ++ R+ G+ ++ G++Y E ++ Sbjct: 28 PDKPQWPSTYSATVE---WRSNHHPHHKFFRMFWDEKNCRARVGGMVKWKGKHYKMEALY 84 Query: 91 NHNEKKEYMVFYQDNFATCFTRPINSSSL 5 + Y +FY+ + CFT + + ++ Sbjct: 85 YGKKNAAYYIFYERDQVKCFTMDLKNKTI 113