BLASTX nr result
ID: Cornus23_contig00035715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00035715 (366 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX96326.1| regulatory protein cys-3/bZIP transcription facto... 50 7e-10 ref|XP_003847911.1| hypothetical protein MYCGRDRAFT_106319 [Zymo... 50 9e-10 ref|XP_007675323.1| hypothetical protein BAUCODRAFT_33466 [Baudo... 42 2e-07 >gb|KJX96326.1| regulatory protein cys-3/bZIP transcription factor (MetR) [Zymoseptoria brevis] Length = 240 Score = 50.1 bits (118), Expect(2) = 7e-10 Identities = 32/58 (55%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -1 Query: 168 NTEFFDFDQFNPNATVFPEP--AEKQNGAQQFPPFDQFSGFAPQTAVNSPSTTGISSP 1 N EFFDFDQFNPNA FPE K QF F F P TAV SP+T ISSP Sbjct: 47 NAEFFDFDQFNPNAAGFPENDIVAKTETPFQFGDFGAF----PSTAVTSPTT--ISSP 98 Score = 40.0 bits (92), Expect(2) = 7e-10 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 314 MSAYTGNGRRAPNVSQYLHNLNTAPTAQE 228 MS Y N RRAPNVSQYL NLNT P+ Q+ Sbjct: 1 MSGY--NPRRAPNVSQYLQNLNTIPSPQD 27 >ref|XP_003847911.1| hypothetical protein MYCGRDRAFT_106319 [Zymoseptoria tritici IPO323] gi|339467785|gb|EGP82887.1| hypothetical protein MYCGRDRAFT_106319 [Zymoseptoria tritici IPO323] Length = 240 Score = 49.7 bits (117), Expect(2) = 9e-10 Identities = 32/58 (55%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -1 Query: 168 NTEFFDFDQFNPNATVFPEP--AEKQNGAQQFPPFDQFSGFAPQTAVNSPSTTGISSP 1 N EFFDFDQFNPNA FP+ K QF F F P TAV SPST ISSP Sbjct: 47 NAEFFDFDQFNPNAAGFPQNDIVAKPETPFQFGDFGAF----PPTAVTSPST--ISSP 98 Score = 40.0 bits (92), Expect(2) = 9e-10 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 314 MSAYTGNGRRAPNVSQYLHNLNTAPTAQE 228 MS Y N RRAPNVSQYL NLNT P+ Q+ Sbjct: 1 MSGY--NPRRAPNVSQYLQNLNTIPSPQD 27 >ref|XP_007675323.1| hypothetical protein BAUCODRAFT_33466 [Baudoinia panamericana UAMH 10762] gi|449301728|gb|EMC97739.1| hypothetical protein BAUCODRAFT_33466 [Baudoinia panamericana UAMH 10762] Length = 273 Score = 42.0 bits (97), Expect(2) = 2e-07 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 290 RRAPNVSQYLHNLNTAPTAQELPTNNTT 207 RRAPNVS YL NLNT PTA EL N T Sbjct: 6 RRAPNVSAYLANLNTIPTANELAAQNDT 33 Score = 39.7 bits (91), Expect(2) = 2e-07 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Frame = -1 Query: 168 NTEFFDFDQFNP-----NATVFPEPAEKQNGAQQFPPFDQFSGFAPQTAVNSPSTTG 13 NTEFFDFDQFNP A PE A++Q QQ P +PQ A ++ +G Sbjct: 47 NTEFFDFDQFNPIDGDFAAQTLPEAAQQQQQPQQQQPLP-----SPQKAGSNGGASG 98