BLASTX nr result
ID: Cornus23_contig00035625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00035625 (337 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCD51444.1| similar to seryl-tRNA synthetase [Botrytis ciner... 58 2e-06 ref|XP_001555398.1| hypothetical protein BC1G_06103 [Botrytis ci... 58 2e-06 ref|XP_001555397.1| hypothetical protein BC1G_06102 [Botrytis ci... 58 2e-06 gb|KFY25482.1| hypothetical protein V493_04621 [Pseudogymnoascus... 56 9e-06 >emb|CCD51444.1| similar to seryl-tRNA synthetase [Botrytis cinerea T4] gi|472240026|gb|EMR84809.1| putative seryl-trna synthetase protein [Botrytis cinerea BcDW1] Length = 480 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 337 PLRKYLPGAVEFIPFSKVLPKDASSQRVKGKSEIA 233 PLRKYLPGA EFIPFSK LPKD +SQ+ KGK+E A Sbjct: 422 PLRKYLPGAPEFIPFSKELPKDTTSQKAKGKAEKA 456 >ref|XP_001555398.1| hypothetical protein BC1G_06103 [Botrytis cinerea B05.10] Length = 471 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 337 PLRKYLPGAVEFIPFSKVLPKDASSQRVKGKSEIA 233 PLRKYLPGA EFIPFSK LPKD +SQ+ KGK+E A Sbjct: 413 PLRKYLPGAPEFIPFSKELPKDTTSQKAKGKAEKA 447 >ref|XP_001555397.1| hypothetical protein BC1G_06102 [Botrytis cinerea B05.10] Length = 271 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 337 PLRKYLPGAVEFIPFSKVLPKDASSQRVKGKSEIA 233 PLRKYLPGA EFIPFSK LPKD +SQ+ KGK+E A Sbjct: 213 PLRKYLPGAPEFIPFSKELPKDTTSQKAKGKAEKA 247 >gb|KFY25482.1| hypothetical protein V493_04621 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] Length = 669 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 337 PLRKYLPGAVEFIPFSKVLPKDASSQRVKGKSE 239 PLRKYLPGA EFIPF+K LPKD++SQ+VK K+E Sbjct: 612 PLRKYLPGAPEFIPFTKELPKDSTSQKVKAKAE 644