BLASTX nr result
ID: Cornus23_contig00035541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00035541 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003609605.1| hypothetical protein MTR_4g119090 [Medicago ... 66 1e-08 ref|XP_007026086.1| Uncharacterized protein TCM_030231 [Theobrom... 63 8e-08 ref|XP_003608418.1| hypothetical protein MTR_4g093880 [Medicago ... 63 8e-08 gb|KRH50745.1| hypothetical protein GLYMA_07G240700 [Glycine max] 60 8e-07 ref|XP_003629394.1| hypothetical protein MTR_8g076870 [Medicago ... 59 1e-06 ref|XP_003593252.1| oligosaccaryltransferase [Medicago truncatul... 57 5e-06 >ref|XP_003609605.1| hypothetical protein MTR_4g119090 [Medicago truncatula] gi|355510660|gb|AES91802.1| hypothetical protein MTR_4g119090 [Medicago truncatula] Length = 60 Score = 65.9 bits (159), Expect = 1e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 104 QVCKKTRVCGCWDSSPGLHGHNVEFLPLNYSH 9 ++ +K ++CGCWDSSPGLHGHNVEFLPLNYSH Sbjct: 3 KIGRKKKLCGCWDSSPGLHGHNVEFLPLNYSH 34 >ref|XP_007026086.1| Uncharacterized protein TCM_030231 [Theobroma cacao] gi|508781452|gb|EOY28708.1| Uncharacterized protein TCM_030231 [Theobroma cacao] Length = 103 Score = 63.2 bits (152), Expect = 8e-08 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 95 KKTRVCGCWDSSPGLHGHNVEFLPLNYSH 9 +K CGCWDSSPGLHGHNVEFLPLNYSH Sbjct: 56 QKPEQCGCWDSSPGLHGHNVEFLPLNYSH 84 >ref|XP_003608418.1| hypothetical protein MTR_4g093880 [Medicago truncatula] gi|355509473|gb|AES90615.1| hypothetical protein MTR_4g093880 [Medicago truncatula] Length = 60 Score = 63.2 bits (152), Expect = 8e-08 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 92 KTRVCGCWDSSPGLHGHNVEFLPLNYSH 9 K CGCWDSSPGLHGHNVEFLPLNYSH Sbjct: 20 KKEFCGCWDSSPGLHGHNVEFLPLNYSH 47 >gb|KRH50745.1| hypothetical protein GLYMA_07G240700 [Glycine max] Length = 294 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 11 GCSLVVRIPRCGRGDLGSNPSSHTLEFFCKL 103 GCSLVVRIPRCGRGDLGSNPSSHTL F +L Sbjct: 263 GCSLVVRIPRCGRGDLGSNPSSHTLLFHLRL 293 >ref|XP_003629394.1| hypothetical protein MTR_8g076870 [Medicago truncatula] gi|355523416|gb|AET03870.1| hypothetical protein MTR_8g076870 [Medicago truncatula] Length = 57 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -2 Query: 96 QKNSSVWLLGFEPRSPRPQRGILTTKLQPQGC 1 +K VWLLGFEPRSPRPQRGILTTKLQP C Sbjct: 4 EKKRCVWLLGFEPRSPRPQRGILTTKLQPHWC 35 >ref|XP_003593252.1| oligosaccaryltransferase [Medicago truncatula] gi|355482300|gb|AES63503.1| oligosaccaryltransferase [Medicago truncatula] Length = 119 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +1 Query: 19 FSGKNSTLWPWRPGLESQQPHTRVF 93 FSGKNSTLWPWRPGLESQQPHT +F Sbjct: 55 FSGKNSTLWPWRPGLESQQPHTSLF 79