BLASTX nr result
ID: Cornus23_contig00034896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00034896 (276 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF10933.1| putative delta-9 desaturase protein A [Sphaerulin... 86 1e-14 ref|XP_007684880.1| hypothetical protein COCMIDRAFT_86717 [Bipol... 64 3e-08 ref|XP_007716450.1| hypothetical protein COCCADRAFT_107000 [Bipo... 64 3e-08 ref|XP_014076202.1| hypothetical protein COCC4DRAFT_42885 [Bipol... 64 3e-08 ref|XP_007699395.1| hypothetical protein COCSADRAFT_141090 [Bipo... 64 3e-08 gb|KNG52058.1| acyl-CoA desaturase [Stemphylium lycopersici] 64 4e-08 ref|XP_001941528.1| acyl-CoA desaturase (Delta(9)-desaturase [Py... 62 1e-07 ref|XP_008028381.1| hypothetical protein SETTUDRAFT_164287 [Seto... 62 2e-07 ref|XP_003302468.1| hypothetical protein PTT_14294 [Pyrenophora ... 62 2e-07 ref|XP_007679616.1| hypothetical protein BAUCODRAFT_243064 [Baud... 58 3e-06 >gb|EMF10933.1| putative delta-9 desaturase protein A [Sphaerulina musiva SO2202] Length = 483 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -3 Query: 127 MPSHQPTAGMMAIDPDKISEERKAPTMASKNEPNRNPKYDPK 2 MPSHQPTAGM+A+DP+KISEERK+P MASKNEPNRNPKYDPK Sbjct: 1 MPSHQPTAGMLAVDPEKISEERKSPVMASKNEPNRNPKYDPK 42 >ref|XP_007684880.1| hypothetical protein COCMIDRAFT_86717 [Bipolaris oryzae ATCC 44560] gi|576935154|gb|EUC48661.1| hypothetical protein COCMIDRAFT_86717 [Bipolaris oryzae ATCC 44560] Length = 480 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 127 MPSHQPTAGMMAIDPDKISEERKAPTMASKNEPNRNPKYDPK 2 MPSHQPTAGMMA+DPD + ++ +MAS +EPNRNPKYDPK Sbjct: 1 MPSHQPTAGMMAVDPDYV---KQPSSMASTSEPNRNPKYDPK 39 >ref|XP_007716450.1| hypothetical protein COCCADRAFT_107000 [Bipolaris zeicola 26-R-13] gi|953434107|ref|XP_014559125.1| hypothetical protein COCVIDRAFT_92700 [Bipolaris victoriae FI3] gi|576914932|gb|EUC29258.1| hypothetical protein COCCADRAFT_107000 [Bipolaris zeicola 26-R-13] gi|578492135|gb|EUN29537.1| hypothetical protein COCVIDRAFT_92700 [Bipolaris victoriae FI3] Length = 480 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 127 MPSHQPTAGMMAIDPDKISEERKAPTMASKNEPNRNPKYDPK 2 MPSHQPTAGMMA+DPD + ++ +MAS +EPNRNPKYDPK Sbjct: 1 MPSHQPTAGMMAVDPDYV---KQPSSMASTSEPNRNPKYDPK 39 >ref|XP_014076202.1| hypothetical protein COCC4DRAFT_42885 [Bipolaris maydis ATCC 48331] gi|451995660|gb|EMD88128.1| hypothetical protein COCHEDRAFT_1183503 [Bipolaris maydis C5] gi|477585204|gb|ENI02293.1| hypothetical protein COCC4DRAFT_42885 [Bipolaris maydis ATCC 48331] Length = 480 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 127 MPSHQPTAGMMAIDPDKISEERKAPTMASKNEPNRNPKYDPK 2 MPSHQPTAGMMA+DPD + ++ +MAS +EPNRNPKYDPK Sbjct: 1 MPSHQPTAGMMAVDPDYV---KQPSSMASTSEPNRNPKYDPK 39 >ref|XP_007699395.1| hypothetical protein COCSADRAFT_141090 [Bipolaris sorokiniana ND90Pr] gi|451851540|gb|EMD64838.1| hypothetical protein COCSADRAFT_141090 [Bipolaris sorokiniana ND90Pr] Length = 480 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 127 MPSHQPTAGMMAIDPDKISEERKAPTMASKNEPNRNPKYDPK 2 MPSHQPTAGMMA+DPD + ++ +MAS +EPNRNPKYDPK Sbjct: 1 MPSHQPTAGMMAVDPDYV---KQPSSMASTSEPNRNPKYDPK 39 >gb|KNG52058.1| acyl-CoA desaturase [Stemphylium lycopersici] Length = 1103 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 127 MPSHQPTAGMMAIDPDKISEERKAPTMASKNEPNRNPKYDPK 2 MPSHQPTAGMMA+DPD + ++ MAS +EPNRNPKYDPK Sbjct: 1 MPSHQPTAGMMAVDPDYV---KQGSPMASTSEPNRNPKYDPK 39 >ref|XP_001941528.1| acyl-CoA desaturase (Delta(9)-desaturase [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977621|gb|EDU44247.1| acyl-CoA desaturase (Delta(9)-desaturase [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 448 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 127 MPSHQPTAGMMAIDPDKISEERKAPTMASKNEPNRNPKYDPK 2 MPSHQPTAGMMA+DP+ I ++ MAS +EPNRNPKYDPK Sbjct: 1 MPSHQPTAGMMAVDPEYI---KQPSPMASTSEPNRNPKYDPK 39 >ref|XP_008028381.1| hypothetical protein SETTUDRAFT_164287 [Setosphaeria turcica Et28A] gi|482806884|gb|EOA83936.1| hypothetical protein SETTUDRAFT_164287 [Setosphaeria turcica Et28A] Length = 480 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 127 MPSHQPTAGMMAIDPDKISEERKAPTMASKNEPNRNPKYDPK 2 MPSHQPTAGMMA+DPD ++ MAS +EPNRNPKYDPK Sbjct: 1 MPSHQPTAGMMAVDPD---YTKQPSPMASTSEPNRNPKYDPK 39 >ref|XP_003302468.1| hypothetical protein PTT_14294 [Pyrenophora teres f. teres 0-1] gi|311322143|gb|EFQ89421.1| hypothetical protein PTT_14294 [Pyrenophora teres f. teres 0-1] Length = 480 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 127 MPSHQPTAGMMAIDPDKISEERKAPTMASKNEPNRNPKYDPK 2 MPSHQPTAGMMA+DP+ + ++ MAS +EPNRNPKYDPK Sbjct: 1 MPSHQPTAGMMAVDPEYV---KQPSPMASTSEPNRNPKYDPK 39 >ref|XP_007679616.1| hypothetical protein BAUCODRAFT_243064 [Baudoinia panamericana UAMH 10762] gi|449297467|gb|EMC93485.1| hypothetical protein BAUCODRAFT_243064 [Baudoinia panamericana UAMH 10762] Length = 485 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -3 Query: 127 MPSHQPTAGMMAIDPDKISEERKAPTMASKNEPNRNPKYDPK 2 MPSHQPTAGMMA+DP K+S A + + EP RN KYDPK Sbjct: 1 MPSHQPTAGMMAVDPTKLSSMPSAASKPAPEEPVRNQKYDPK 42