BLASTX nr result
ID: Cornus23_contig00034852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00034852 (265 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIJ04693.1| 14-3-3d [Morus alba var. atropurpurea] 171 2e-40 emb|CBI27277.3| unnamed protein product [Vitis vinifera] 171 2e-40 ref|XP_002269100.1| PREDICTED: 14-3-3-like protein GF14 iota [Vi... 171 2e-40 emb|CDP00422.1| unnamed protein product [Coffea canephora] 170 4e-40 ref|XP_012847621.1| PREDICTED: 14-3-3-like protein GF14 iota iso... 169 1e-39 ref|XP_012847623.1| PREDICTED: 14-3-3-like protein GF14 iota iso... 169 1e-39 ref|XP_012847622.1| PREDICTED: 14-3-3-like protein GF14 iota iso... 169 1e-39 ref|XP_007045894.1| General regulatory factor 12, IOTA isoform 2... 169 1e-39 ref|XP_007045893.1| General regulatory factor 12, IOTA isoform 1... 169 1e-39 ref|XP_006365133.1| PREDICTED: 14-3-3-like protein GF14 iota-lik... 168 1e-39 ref|XP_004228408.1| PREDICTED: 14-3-3-like protein GF14 iota [So... 168 1e-39 gb|ABO15468.1| 14-3-3 protein Lil 1433-3 [Lilium longiflorum] 168 1e-39 ref|XP_011463022.1| PREDICTED: 14-3-3-like protein GF14 iota [Fr... 168 2e-39 ref|XP_009794399.1| PREDICTED: 14-3-3-like protein GF14 iota [Ni... 168 2e-39 ref|XP_009624793.1| PREDICTED: 14-3-3-like protein GF14 iota [Ni... 167 2e-39 ref|XP_008221499.1| PREDICTED: 14-3-3-like protein GF14 iota [Pr... 167 2e-39 ref|XP_007227176.1| hypothetical protein PRUPE_ppa020788mg, part... 167 2e-39 gb|ABO15467.1| 14-3-3 protein Lil 1433-2 [Lilium longiflorum] 167 4e-39 gb|KJB80355.1| hypothetical protein B456_013G093400 [Gossypium r... 166 5e-39 ref|XP_012461792.1| PREDICTED: 14-3-3-like protein GF14 iota [Go... 166 5e-39 >gb|AIJ04693.1| 14-3-3d [Morus alba var. atropurpurea] Length = 260 Score = 171 bits (433), Expect = 2e-40 Identities = 84/87 (96%), Positives = 86/87 (98%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVE+ELSKIC+DILT Sbjct: 47 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEDELSKICSDILT 106 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSS SGEATVFYYKMKGDYY Sbjct: 107 IIDKHLIPSSASGEATVFYYKMKGDYY 133 >emb|CBI27277.3| unnamed protein product [Vitis vinifera] Length = 253 Score = 171 bits (433), Expect = 2e-40 Identities = 85/87 (97%), Positives = 85/87 (97%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE NVKLIKGYRQKVEEELSKIC DILT Sbjct: 34 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEQNVKLIKGYRQKVEEELSKICGDILT 93 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSSGSGEATVFYYKMKGDYY Sbjct: 94 IIDKHLIPSSGSGEATVFYYKMKGDYY 120 >ref|XP_002269100.1| PREDICTED: 14-3-3-like protein GF14 iota [Vitis vinifera] Length = 260 Score = 171 bits (433), Expect = 2e-40 Identities = 85/87 (97%), Positives = 85/87 (97%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE NVKLIKGYRQKVEEELSKIC DILT Sbjct: 46 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEQNVKLIKGYRQKVEEELSKICGDILT 105 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSSGSGEATVFYYKMKGDYY Sbjct: 106 IIDKHLIPSSGSGEATVFYYKMKGDYY 132 >emb|CDP00422.1| unnamed protein product [Coffea canephora] Length = 253 Score = 170 bits (430), Expect = 4e-40 Identities = 83/87 (95%), Positives = 87/87 (100%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE+NVKLIKGYRQKVE+ELSKIC+DILT Sbjct: 46 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKGYRQKVEDELSKICSDILT 105 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSSGSGEATVFYYKMKGDY+ Sbjct: 106 IIDKHLIPSSGSGEATVFYYKMKGDYF 132 >ref|XP_012847621.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X1 [Erythranthe guttatus] Length = 260 Score = 169 bits (427), Expect = 1e-39 Identities = 82/87 (94%), Positives = 86/87 (98%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEN+VKLIKGYRQKVE+ELSKIC DIL+ Sbjct: 46 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENHVKLIKGYRQKVEDELSKICQDILS 105 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 +IDKHLIPSSGSGEATVFYYKMKGDYY Sbjct: 106 VIDKHLIPSSGSGEATVFYYKMKGDYY 132 >ref|XP_012847623.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X3 [Erythranthe guttatus] gi|604316663|gb|EYU28855.1| hypothetical protein MIMGU_mgv1a012202mg [Erythranthe guttata] Length = 257 Score = 169 bits (427), Expect = 1e-39 Identities = 82/87 (94%), Positives = 86/87 (98%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEN+VKLIKGYRQKVE+ELSKIC DIL+ Sbjct: 46 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENHVKLIKGYRQKVEDELSKICQDILS 105 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 +IDKHLIPSSGSGEATVFYYKMKGDYY Sbjct: 106 VIDKHLIPSSGSGEATVFYYKMKGDYY 132 >ref|XP_012847622.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X2 [Erythranthe guttatus] gi|604316662|gb|EYU28854.1| hypothetical protein MIMGU_mgv1a012202mg [Erythranthe guttata] Length = 258 Score = 169 bits (427), Expect = 1e-39 Identities = 82/87 (94%), Positives = 86/87 (98%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEN+VKLIKGYRQKVE+ELSKIC DIL+ Sbjct: 46 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENHVKLIKGYRQKVEDELSKICQDILS 105 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 +IDKHLIPSSGSGEATVFYYKMKGDYY Sbjct: 106 VIDKHLIPSSGSGEATVFYYKMKGDYY 132 >ref|XP_007045894.1| General regulatory factor 12, IOTA isoform 2 [Theobroma cacao] gi|508709829|gb|EOY01726.1| General regulatory factor 12, IOTA isoform 2 [Theobroma cacao] Length = 261 Score = 169 bits (427), Expect = 1e-39 Identities = 84/87 (96%), Positives = 84/87 (96%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE NVKLIKGYRQKVEEELSKICTDIL Sbjct: 47 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEENVKLIKGYRQKVEEELSKICTDILG 106 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSS SGEATVFYYKMKGDYY Sbjct: 107 IIDKHLIPSSNSGEATVFYYKMKGDYY 133 >ref|XP_007045893.1| General regulatory factor 12, IOTA isoform 1 [Theobroma cacao] gi|508709828|gb|EOY01725.1| General regulatory factor 12, IOTA isoform 1 [Theobroma cacao] Length = 307 Score = 169 bits (427), Expect = 1e-39 Identities = 84/87 (96%), Positives = 84/87 (96%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE NVKLIKGYRQKVEEELSKICTDIL Sbjct: 47 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEENVKLIKGYRQKVEEELSKICTDILG 106 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSS SGEATVFYYKMKGDYY Sbjct: 107 IIDKHLIPSSNSGEATVFYYKMKGDYY 133 >ref|XP_006365133.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Solanum tuberosum] Length = 274 Score = 168 bits (426), Expect = 1e-39 Identities = 83/87 (95%), Positives = 85/87 (97%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKIC DIL Sbjct: 46 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICHDILE 105 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSSG+GEATVFYYKMKGDY+ Sbjct: 106 IIDKHLIPSSGTGEATVFYYKMKGDYF 132 >ref|XP_004228408.1| PREDICTED: 14-3-3-like protein GF14 iota [Solanum lycopersicum] Length = 274 Score = 168 bits (426), Expect = 1e-39 Identities = 83/87 (95%), Positives = 85/87 (97%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKIC DIL Sbjct: 46 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICHDILE 105 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSSG+GEATVFYYKMKGDY+ Sbjct: 106 IIDKHLIPSSGTGEATVFYYKMKGDYF 132 >gb|ABO15468.1| 14-3-3 protein Lil 1433-3 [Lilium longiflorum] Length = 260 Score = 168 bits (426), Expect = 1e-39 Identities = 82/87 (94%), Positives = 84/87 (96%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGN+ NVKLIKGYR KVEEELSKIC DILT Sbjct: 46 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNDQNVKLIKGYRHKVEEELSKICNDILT 105 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 +IDKHLIPSSGSGEATVFYYKMKGDYY Sbjct: 106 VIDKHLIPSSGSGEATVFYYKMKGDYY 132 >ref|XP_011463022.1| PREDICTED: 14-3-3-like protein GF14 iota [Fragaria vesca subsp. vesca] Length = 263 Score = 168 bits (425), Expect = 2e-39 Identities = 83/87 (95%), Positives = 85/87 (97%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE+NVKLIK YRQKVEEELSKIC+DILT Sbjct: 47 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKSYRQKVEEELSKICSDILT 106 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSS SGEATVFYYKMKGDYY Sbjct: 107 IIDKHLIPSSSSGEATVFYYKMKGDYY 133 >ref|XP_009794399.1| PREDICTED: 14-3-3-like protein GF14 iota [Nicotiana sylvestris] Length = 275 Score = 168 bits (425), Expect = 2e-39 Identities = 82/87 (94%), Positives = 86/87 (98%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE+NVKLIKGYRQKVEEELSKIC+DIL Sbjct: 46 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKGYRQKVEEELSKICSDILE 105 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPS+G+GEATVFYYKMKGDYY Sbjct: 106 IIDKHLIPSAGTGEATVFYYKMKGDYY 132 >ref|XP_009624793.1| PREDICTED: 14-3-3-like protein GF14 iota [Nicotiana tomentosiformis] Length = 275 Score = 167 bits (424), Expect = 2e-39 Identities = 82/87 (94%), Positives = 85/87 (97%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE NVKLIKGYRQKVEEELSKIC+DIL Sbjct: 46 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEQNVKLIKGYRQKVEEELSKICSDILE 105 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPS+G+GEATVFYYKMKGDYY Sbjct: 106 IIDKHLIPSAGTGEATVFYYKMKGDYY 132 >ref|XP_008221499.1| PREDICTED: 14-3-3-like protein GF14 iota [Prunus mume] Length = 263 Score = 167 bits (424), Expect = 2e-39 Identities = 83/87 (95%), Positives = 85/87 (97%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE+NVKLIKGYRQKVEEELSKIC DIL+ Sbjct: 47 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKGYRQKVEEELSKICNDILS 106 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSS SGEATVFYYKMKGDYY Sbjct: 107 IIDKHLIPSSTSGEATVFYYKMKGDYY 133 >ref|XP_007227176.1| hypothetical protein PRUPE_ppa020788mg, partial [Prunus persica] gi|462424112|gb|EMJ28375.1| hypothetical protein PRUPE_ppa020788mg, partial [Prunus persica] Length = 262 Score = 167 bits (424), Expect = 2e-39 Identities = 83/87 (95%), Positives = 85/87 (97%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE+NVKLIKGYRQKVEEELSKIC DIL+ Sbjct: 47 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKGYRQKVEEELSKICNDILS 106 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSS SGEATVFYYKMKGDYY Sbjct: 107 IIDKHLIPSSTSGEATVFYYKMKGDYY 133 >gb|ABO15467.1| 14-3-3 protein Lil 1433-2 [Lilium longiflorum] Length = 260 Score = 167 bits (422), Expect = 4e-39 Identities = 81/87 (93%), Positives = 85/87 (97%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE NVKLIKGYRQKVE+EL+KIC DILT Sbjct: 46 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEQNVKLIKGYRQKVEDELAKICNDILT 105 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IID+HLIPSSGSGE+TVFYYKMKGDYY Sbjct: 106 IIDQHLIPSSGSGESTVFYYKMKGDYY 132 >gb|KJB80355.1| hypothetical protein B456_013G093400 [Gossypium raimondii] Length = 240 Score = 166 bits (421), Expect = 5e-39 Identities = 82/87 (94%), Positives = 84/87 (96%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE NVKLIKGYR+KVEEELS ICTDIL+ Sbjct: 21 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEENVKLIKGYRRKVEEELSNICTDILS 80 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSS SGEATVFYYKMKGDYY Sbjct: 81 IIDKHLIPSSSSGEATVFYYKMKGDYY 107 >ref|XP_012461792.1| PREDICTED: 14-3-3-like protein GF14 iota [Gossypium raimondii] gi|763813502|gb|KJB80354.1| hypothetical protein B456_013G093400 [Gossypium raimondii] Length = 266 Score = 166 bits (421), Expect = 5e-39 Identities = 82/87 (94%), Positives = 84/87 (96%) Frame = -3 Query: 263 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICTDILT 84 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNE NVKLIKGYR+KVEEELS ICTDIL+ Sbjct: 47 NLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEENVKLIKGYRRKVEEELSNICTDILS 106 Query: 83 IIDKHLIPSSGSGEATVFYYKMKGDYY 3 IIDKHLIPSS SGEATVFYYKMKGDYY Sbjct: 107 IIDKHLIPSSSSGEATVFYYKMKGDYY 133