BLASTX nr result
ID: Cornus23_contig00034660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00034660 (387 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001793040.1| hypothetical protein SNOG_02436 [Parastagono... 57 4e-06 >ref|XP_001793040.1| hypothetical protein SNOG_02436 [Parastagonospora nodorum SN15] gi|160704564|gb|EAT90648.2| hypothetical protein SNOG_02436 [Parastagonospora nodorum SN15] Length = 350 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -1 Query: 387 PPLTKPGRRSSSNAHLPPPATKDKLTTPQISKRKSFLSVFRR 262 P L+KP ++S S AHLPPP TPQISKRKSFLSVFRR Sbjct: 309 PILSKPTKKSGSYAHLPPPPIPQDKPTPQISKRKSFLSVFRR 350