BLASTX nr result
ID: Cornus23_contig00034643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00034643 (275 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFE68559.1| LOW QUALITY PROTEIN: conserved hypothetical prote... 58 3e-06 >gb|EFE68559.1| LOW QUALITY PROTEIN: conserved hypothetical protein, partial [Streptomyces ghanaensis ATCC 14672] Length = 91 Score = 57.8 bits (138), Expect = 3e-06 Identities = 34/69 (49%), Positives = 37/69 (53%) Frame = +1 Query: 1 AFLDSTGSLTHPQPWAPHHASTFTPSGFTYQTVHTLSPGQPSPGMSYLTASLRSLPTT*S 180 AFLDS GS T PQ A H S P GF Y T +TL+PGQP PG+ L AS PT Sbjct: 14 AFLDSIGSSTSPQS-ARHRVSDDVPGGFAYLTSYTLTPGQPPPGLDCLPASPHHSPTNRL 72 Query: 181 VHTLTHPRS 207 L H S Sbjct: 73 GRRLHHSPS 81