BLASTX nr result
ID: Cornus23_contig00034588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00034588 (309 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNG51264.1| alkaline serine protease alp1 [Stemphylium lycope... 75 3e-11 ref|XP_007701761.1| hypothetical protein COCSADRAFT_120979 [Bipo... 73 7e-11 ref|XP_001939017.1| oryzin precursor [Pyrenophora tritici-repent... 71 4e-10 ref|XP_014558239.1| hypothetical protein COCVIDRAFT_36444 [Bipol... 70 6e-10 ref|XP_007692184.1| hypothetical protein COCMIDRAFT_29905 [Bipol... 70 6e-10 ref|XP_007713913.1| hypothetical protein COCCADRAFT_38174 [Bipol... 70 6e-10 ref|XP_014075931.1| hypothetical protein COCC4DRAFT_146693 [Bipo... 69 1e-09 ref|XP_003839596.1| similar to subtilisin-like protease [Leptosp... 66 9e-09 ref|XP_008024558.1| hypothetical protein SETTUDRAFT_39300 [Setos... 65 2e-08 gb|KNG50766.1| alkaline serine protease alp1 [Stemphylium lycope... 63 8e-08 ref|XP_003298312.1| hypothetical protein PTT_08980 [Pyrenophora ... 63 1e-07 ref|XP_001803422.1| hypothetical protein SNOG_13210 [Parastagono... 60 8e-07 ref|XP_008024301.1| hypothetical protein SETTUDRAFT_149807 [Seto... 58 2e-06 >gb|KNG51264.1| alkaline serine protease alp1 [Stemphylium lycopersici] Length = 411 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGNNKQAKV 162 SY+R LEGPSTAA VKAR++ALA P VTDTLGS NLLAYNGNN ++V Sbjct: 363 SYLRALEGPSTAAEVKARVYALATPDVVTDTLGSVNLLAYNGNNMSSRV 411 >ref|XP_007701761.1| hypothetical protein COCSADRAFT_120979 [Bipolaris sorokiniana ND90Pr] gi|451849066|gb|EMD62370.1| hypothetical protein COCSADRAFT_120979 [Bipolaris sorokiniana ND90Pr] Length = 406 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGN 180 SY+RGLEGPSTAA VKAR++ LA PG VTDT+GSANLLAYNGN Sbjct: 363 SYLRGLEGPSTAAAVKARVYQLATPGVVTDTMGSANLLAYNGN 405 >ref|XP_001939017.1| oryzin precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187986116|gb|EDU51604.1| oryzin precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 408 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGN 180 SY+RGLEGP +A +VKAR++ALA PG VTDT+GSANLLAYNGN Sbjct: 365 SYLRGLEGPMSARDVKARVYALATPGVVTDTMGSANLLAYNGN 407 >ref|XP_014558239.1| hypothetical protein COCVIDRAFT_36444 [Bipolaris victoriae FI3] gi|578491253|gb|EUN28662.1| hypothetical protein COCVIDRAFT_36444 [Bipolaris victoriae FI3] Length = 406 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGN 180 SY+RGLEGPSTAA VKAR++ L PG VTDT+GS NLLAYNGN Sbjct: 363 SYLRGLEGPSTAAAVKARVYQLGTPGVVTDTMGSVNLLAYNGN 405 >ref|XP_007692184.1| hypothetical protein COCMIDRAFT_29905 [Bipolaris oryzae ATCC 44560] gi|576927613|gb|EUC41291.1| hypothetical protein COCMIDRAFT_29905 [Bipolaris oryzae ATCC 44560] Length = 406 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGN 180 SY+RGLEGPSTAA VKAR++ L PG VTDT+GS NLLAYNGN Sbjct: 363 SYLRGLEGPSTAAAVKARVYQLGTPGVVTDTMGSVNLLAYNGN 405 >ref|XP_007713913.1| hypothetical protein COCCADRAFT_38174 [Bipolaris zeicola 26-R-13] gi|576917541|gb|EUC31760.1| hypothetical protein COCCADRAFT_38174 [Bipolaris zeicola 26-R-13] Length = 406 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGN 180 SY+RGLEGPSTAA VKAR++ L PG VTDT+GS NLLAYNGN Sbjct: 363 SYLRGLEGPSTAAAVKARVYQLGTPGVVTDTMGSVNLLAYNGN 405 >ref|XP_014075931.1| hypothetical protein COCC4DRAFT_146693 [Bipolaris maydis ATCC 48331] gi|451993546|gb|EMD86019.1| hypothetical protein COCHEDRAFT_112066 [Bipolaris maydis C5] gi|477584932|gb|ENI02022.1| hypothetical protein COCC4DRAFT_146693 [Bipolaris maydis ATCC 48331] Length = 406 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGN 180 SY+RGLEGPSTAA +KAR++ LA PG VTD +GS NLLAYNGN Sbjct: 363 SYLRGLEGPSTAAAIKARVYQLATPGVVTDAMGSVNLLAYNGN 405 >ref|XP_003839596.1| similar to subtilisin-like protease [Leptosphaeria maculans JN3] gi|312216166|emb|CBX96117.1| similar to subtilisin-like protease [Leptosphaeria maculans JN3] Length = 404 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGNNK 174 SY+RGLEG STAA V+AR+ ALA PGRVTD G+ANL+AYNGN + Sbjct: 360 SYLRGLEGLSTAAAVRARVIALATPGRVTDGQGAANLVAYNGNGR 404 >ref|XP_008024558.1| hypothetical protein SETTUDRAFT_39300 [Setosphaeria turcica Et28A] gi|482811069|gb|EOA87849.1| hypothetical protein SETTUDRAFT_39300 [Setosphaeria turcica Et28A] Length = 406 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGN 180 SY+RGLEGPSTAA VKAR++AL P V D +GS NLLAYNGN Sbjct: 363 SYLRGLEGPSTAAAVKARVYALGTPNVVKDPMGSTNLLAYNGN 405 >gb|KNG50766.1| alkaline serine protease alp1 [Stemphylium lycopersici] Length = 402 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGNNK 174 SY+R LEGPS + R+ ALA PGRVTDTLG+ NLLAYNGN + Sbjct: 358 SYLRALEGPSIGPAARTRVLALATPGRVTDTLGAPNLLAYNGNGR 402 >ref|XP_003298312.1| hypothetical protein PTT_08980 [Pyrenophora teres f. teres 0-1] gi|311328570|gb|EFQ93600.1| hypothetical protein PTT_08980 [Pyrenophora teres f. teres 0-1] Length = 407 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGN 180 SY+RGLEGP +AA VKAR++AL P VTD GS NLLAYNGN Sbjct: 364 SYLRGLEGPMSAAAVKARVYALGTPNVVTDAKGSVNLLAYNGN 406 >ref|XP_001803422.1| hypothetical protein SNOG_13210 [Parastagonospora nodorum SN15] gi|160703949|gb|EAT79537.2| hypothetical protein SNOG_13210 [Parastagonospora nodorum SN15] Length = 389 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGNNKQ 171 SYIR LEGP +AA VKARLF LA VTD GS N LAYNGNN++ Sbjct: 344 SYIRALEGPMSAAAVKARLFELATLDVVTDPKGSVNRLAYNGNNRR 389 >ref|XP_008024301.1| hypothetical protein SETTUDRAFT_149807 [Setosphaeria turcica Et28A] gi|482811522|gb|EOA88278.1| hypothetical protein SETTUDRAFT_149807 [Setosphaeria turcica Et28A] Length = 401 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -2 Query: 308 SYIRGLEGPSTAANVKARLFALAIPGRVTDTLGSANLLAYNGNNK 174 SY+R LEGPS +AR+ ALA GR+TDTLG NLLAYNG+ + Sbjct: 357 SYLRALEGPSIGQAARARVLALATTGRLTDTLGGPNLLAYNGSGR 401