BLASTX nr result
ID: Cornus23_contig00034419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00034419 (258 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013442841.1| hypothetical protein MTR_0082s0270 [Medicago... 100 3e-19 ref|XP_013443281.1| hypothetical protein MTR_0024s0130 [Medicago... 99 1e-18 emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] 99 1e-18 ref|XP_002518611.1| conserved hypothetical protein [Ricinus comm... 91 3e-16 gb|KJB09735.1| hypothetical protein B456_001G161100 [Gossypium r... 60 5e-07 >ref|XP_013442841.1| hypothetical protein MTR_0082s0270 [Medicago truncatula] gi|657370805|gb|KEH16866.1| hypothetical protein MTR_0082s0270 [Medicago truncatula] Length = 197 Score = 100 bits (250), Expect = 3e-19 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = +3 Query: 3 TDLFSIGASSNATRFYLTKPRARPRREFALPNSLFDNKAESPDPTFISFE 152 TDLFSIGASS+ATRFYLTKPRARPRREFALPNSLFDNKAE+PDPTFISFE Sbjct: 148 TDLFSIGASSSATRFYLTKPRARPRREFALPNSLFDNKAETPDPTFISFE 197 >ref|XP_013443281.1| hypothetical protein MTR_0024s0130 [Medicago truncatula] gi|657371303|gb|KEH17306.1| hypothetical protein MTR_0024s0130 [Medicago truncatula] Length = 84 Score = 99.0 bits (245), Expect = 1e-18 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 TDLFSIGASSNATRFYLTKPRARPRREFALPNSLFDNKAESPDPTFISFE 152 TDLFSIGASS+ATRFYLTKPRARPRREFALPNSLFDN AE+PDPTFISFE Sbjct: 35 TDLFSIGASSSATRFYLTKPRARPRREFALPNSLFDNNAETPDPTFISFE 84 >emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] Length = 124 Score = 99.0 bits (245), Expect = 1e-18 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 TDLFSIGASSNATRFYLTKPRARPRREFALPNSLFDNKAESPDPTFISFE 152 TDLFSIGASS+ATRFYLTKPRARPRREFALPN LFDNKAESPDPTF+SFE Sbjct: 75 TDLFSIGASSSATRFYLTKPRARPRREFALPNPLFDNKAESPDPTFMSFE 124 >ref|XP_002518611.1| conserved hypothetical protein [Ricinus communis] gi|223542210|gb|EEF43753.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 90.9 bits (224), Expect = 3e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +3 Query: 3 TDLFSIGASSNATRFYLTKPRARPRREFALPNSLFDNKAESPDPTFISFE 152 TDLFSIGASS+ T+FYLTKP A PRREFALPNSLFDNKAE+PD TFISFE Sbjct: 11 TDLFSIGASSSTTQFYLTKPHAHPRREFALPNSLFDNKAETPDQTFISFE 60 >gb|KJB09735.1| hypothetical protein B456_001G161100 [Gossypium raimondii] Length = 250 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 TDLFSIGASSNATRFYLTKPRARPRREFALPNS 101 TDLFSIGASS+ATRFYLTKPRARPRREF NS Sbjct: 145 TDLFSIGASSSATRFYLTKPRARPRREFPATNS 177