BLASTX nr result
ID: Cornus23_contig00034372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00034372 (481 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNG47659.1| cp2 transcription factor family protein [Stemphyl... 69 1e-09 ref|XP_014561771.1| hypothetical protein COCVIDRAFT_33378 [Bipol... 69 1e-09 ref|XP_007683743.1| hypothetical protein COCMIDRAFT_22708 [Bipol... 69 1e-09 ref|XP_007706338.1| hypothetical protein COCCADRAFT_31661 [Bipol... 69 1e-09 ref|XP_014077615.1| hypothetical protein COCC4DRAFT_73358 [Bipol... 69 1e-09 ref|XP_007696182.1| hypothetical protein COCSADRAFT_167842 [Bipo... 69 1e-09 ref|XP_001802374.1| hypothetical protein SNOG_12143 [Parastagono... 68 3e-09 ref|XP_003841549.1| similar to CP2 transcription factor family p... 66 9e-09 ref|XP_007931615.1| hypothetical protein MYCFIDRAFT_96026, parti... 64 4e-08 ref|XP_007584405.1| putative cp2 transcription factor protein [N... 61 4e-07 ref|XP_001933513.1| conserved hypothetical protein [Pyrenophora ... 60 5e-07 ref|XP_007784261.1| hypothetical protein W97_08202 [Coniosporium... 59 1e-06 ref|XP_008022502.1| hypothetical protein SETTUDRAFT_45865 [Setos... 59 1e-06 gb|EMF08838.1| hypothetical protein SEPMUDRAFT_151753 [Sphaeruli... 59 1e-06 gb|EKG10725.1| CP2 transcription factor [Macrophomina phaseolina... 59 1e-06 gb|EME39949.1| hypothetical protein DOTSEDRAFT_74725 [Dothistrom... 59 2e-06 gb|KIW00370.1| hypothetical protein, variant [Verruconis gallopava] 58 3e-06 gb|KIW00369.1| hypothetical protein PV09_08081 [Verruconis gallo... 58 3e-06 ref|XP_003300267.1| hypothetical protein PTT_11463 [Pyrenophora ... 58 3e-06 ref|XP_007672868.1| hypothetical protein BAUCODRAFT_21663 [Baudo... 57 4e-06 >gb|KNG47659.1| cp2 transcription factor family protein [Stemphylium lycopersici] Length = 810 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWDAGPTDIQVDGDISV ENV+STGYELRLLF Sbjct: 777 KREWDAGPTDIQVDGDISVTENVHSTGYELRLLF 810 >ref|XP_014561771.1| hypothetical protein COCVIDRAFT_33378 [Bipolaris victoriae FI3] gi|578494795|gb|EUN32180.1| hypothetical protein COCVIDRAFT_33378 [Bipolaris victoriae FI3] Length = 812 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWDAGPTDIQVDGDISV ENV+STGYELRLLF Sbjct: 779 KREWDAGPTDIQVDGDISVTENVHSTGYELRLLF 812 >ref|XP_007683743.1| hypothetical protein COCMIDRAFT_22708 [Bipolaris oryzae ATCC 44560] gi|576936232|gb|EUC49729.1| hypothetical protein COCMIDRAFT_22708 [Bipolaris oryzae ATCC 44560] Length = 812 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWDAGPTDIQVDGDISV ENV+STGYELRLLF Sbjct: 779 KREWDAGPTDIQVDGDISVTENVHSTGYELRLLF 812 >ref|XP_007706338.1| hypothetical protein COCCADRAFT_31661 [Bipolaris zeicola 26-R-13] gi|576925177|gb|EUC39282.1| hypothetical protein COCCADRAFT_31661 [Bipolaris zeicola 26-R-13] Length = 812 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWDAGPTDIQVDGDISV ENV+STGYELRLLF Sbjct: 779 KREWDAGPTDIQVDGDISVTENVHSTGYELRLLF 812 >ref|XP_014077615.1| hypothetical protein COCC4DRAFT_73358 [Bipolaris maydis ATCC 48331] gi|452004382|gb|EMD96838.1| hypothetical protein COCHEDRAFT_1189785 [Bipolaris maydis C5] gi|477586622|gb|ENI03706.1| hypothetical protein COCC4DRAFT_73358 [Bipolaris maydis ATCC 48331] Length = 811 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWDAGPTDIQVDGDISV ENV+STGYELRLLF Sbjct: 778 KREWDAGPTDIQVDGDISVTENVHSTGYELRLLF 811 >ref|XP_007696182.1| hypothetical protein COCSADRAFT_167842 [Bipolaris sorokiniana ND90Pr] gi|451855339|gb|EMD68631.1| hypothetical protein COCSADRAFT_167842 [Bipolaris sorokiniana ND90Pr] Length = 812 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWDAGPTDIQVDGDISV ENV+STGYELRLLF Sbjct: 779 KREWDAGPTDIQVDGDISVTENVHSTGYELRLLF 812 >ref|XP_001802374.1| hypothetical protein SNOG_12143 [Parastagonospora nodorum SN15] gi|160703514|gb|EAT80555.2| hypothetical protein SNOG_12143 [Parastagonospora nodorum SN15] Length = 776 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWDAGPTDIQVDGDISV ENV+S+GYELRLLF Sbjct: 743 KREWDAGPTDIQVDGDISVTENVHSSGYELRLLF 776 >ref|XP_003841549.1| similar to CP2 transcription factor family protein [Leptosphaeria maculans JN3] gi|312218124|emb|CBX98070.1| similar to CP2 transcription factor family protein [Leptosphaeria maculans JN3] Length = 813 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWDAGPTD+QVDG+I+VIEN++S+GYELRLLF Sbjct: 780 KREWDAGPTDVQVDGEINVIENIHSSGYELRLLF 813 >ref|XP_007931615.1| hypothetical protein MYCFIDRAFT_96026, partial [Pseudocercospora fijiensis CIRAD86] gi|452978095|gb|EME77859.1| hypothetical protein MYCFIDRAFT_96026, partial [Pseudocercospora fijiensis CIRAD86] Length = 807 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWDAGPTDIQ DGD+ IENV+STGYEL+LLF Sbjct: 774 KREWDAGPTDIQCDGDLPTIENVSSTGYELKLLF 807 >ref|XP_007584405.1| putative cp2 transcription factor protein [Neofusicoccum parvum UCRNP2] gi|485922778|gb|EOD48106.1| putative cp2 transcription factor protein [Neofusicoccum parvum UCRNP2] Length = 658 Score = 60.8 bits (146), Expect = 4e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWD+GPTD+QVDGD+ VIE ++GYELRLLF Sbjct: 625 KREWDSGPTDVQVDGDVGVIETTTTSGYELRLLF 658 >ref|XP_001933513.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979077|gb|EDU45703.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 813 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 K EWDAG +IQVDGDISV ENV+STGYELRLLF Sbjct: 780 KHEWDAGSKEIQVDGDISVTENVHSTGYELRLLF 813 >ref|XP_007784261.1| hypothetical protein W97_08202 [Coniosporium apollinis CBS 100218] gi|494832778|gb|EON68944.1| hypothetical protein W97_08202 [Coniosporium apollinis CBS 100218] Length = 616 Score = 59.3 bits (142), Expect = 1e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 +REWD+GPTD+QVDGD+ +EN+ S GYELRL++ Sbjct: 583 RREWDSGPTDVQVDGDLGALENITSAGYELRLIY 616 >ref|XP_008022502.1| hypothetical protein SETTUDRAFT_45865 [Setosphaeria turcica Et28A] gi|482813045|gb|EOA89749.1| hypothetical protein SETTUDRAFT_45865 [Setosphaeria turcica Et28A] Length = 816 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREW+A P DIQVDGDI V E V+STGYELRLLF Sbjct: 783 KREWEADPADIQVDGDIGVAETVHSTGYELRLLF 816 >gb|EMF08838.1| hypothetical protein SEPMUDRAFT_151753 [Sphaerulina musiva SO2202] Length = 852 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWDAGPTDIQ DG++S ENV S GYEL+LLF Sbjct: 819 KREWDAGPTDIQCDGELSTAENVQSHGYELKLLF 852 >gb|EKG10725.1| CP2 transcription factor [Macrophomina phaseolina MS6] Length = 796 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWD+GPTD+QVDGD+ IE ++GYELRLLF Sbjct: 763 KREWDSGPTDVQVDGDVGAIETTTTSGYELRLLF 796 >gb|EME39949.1| hypothetical protein DOTSEDRAFT_74725 [Dothistroma septosporum NZE10] Length = 830 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWD G DIQ DGD+ +IENV+STGYEL+LLF Sbjct: 797 KREWDTGTPDIQCDGDVPIIENVSSTGYELKLLF 830 >gb|KIW00370.1| hypothetical protein, variant [Verruconis gallopava] Length = 677 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWD+GPTDIQVDGDI + V S GYELRLL+ Sbjct: 644 KREWDSGPTDIQVDGDIDIATTVQSEGYELRLLY 677 >gb|KIW00369.1| hypothetical protein PV09_08081 [Verruconis gallopava] Length = 811 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 KREWD+GPTDIQVDGDI + V S GYELRLL+ Sbjct: 778 KREWDSGPTDIQVDGDIDIATTVQSEGYELRLLY 811 >ref|XP_003300267.1| hypothetical protein PTT_11463 [Pyrenophora teres f. teres 0-1] gi|311325682|gb|EFQ91637.1| hypothetical protein PTT_11463 [Pyrenophora teres f. teres 0-1] Length = 872 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 K +WD G +IQVDGDISV ENV+STGYELRLLF Sbjct: 839 KHDWDTGSKEIQVDGDISVTENVHSTGYELRLLF 872 >ref|XP_007672868.1| hypothetical protein BAUCODRAFT_21663 [Baudoinia panamericana UAMH 10762] gi|449303973|gb|EMC99980.1| hypothetical protein BAUCODRAFT_21663 [Baudoinia panamericana UAMH 10762] Length = 848 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 480 KREWDAGPTDIQVDGDISVIENVNSTGYELRLLF 379 +REWDAGPTDIQ DGD+ + N S+GYELRLLF Sbjct: 815 RREWDAGPTDIQCDGDVPTVHNTFSSGYELRLLF 848