BLASTX nr result
ID: Cornus23_contig00034351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00034351 (316 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007834816.1| hypothetical protein PFICI_08044 [Pestalotio... 135 1e-29 >ref|XP_007834816.1| hypothetical protein PFICI_08044 [Pestalotiopsis fici W106-1] gi|573060753|gb|ETS80515.1| hypothetical protein PFICI_08044 [Pestalotiopsis fici W106-1] Length = 72 Score = 135 bits (340), Expect = 1e-29 Identities = 64/72 (88%), Positives = 67/72 (93%) Frame = -3 Query: 311 MPPSGTESAKQKFQEGIDKTRQAADPNSGPTGTNPKQGNFISKLAKGETEASTYTAKGGP 132 MPPSGTE AKQKFQEGI KTR ADP+SGPTGTNPK G+F+SKLAKGETEASTYTAKGGP Sbjct: 1 MPPSGTEQAKQKFQEGIQKTRAPADPSSGPTGTNPKLGDFVSKLAKGETEASTYTAKGGP 60 Query: 131 SGTDRTKEPGGL 96 SGTDRTKEPGGL Sbjct: 61 SGTDRTKEPGGL 72