BLASTX nr result
ID: Cornus23_contig00034121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00034121 (321 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018099.1| Glutamate receptor 3.3 isoform 6 [Theobroma ... 57 5e-06 ref|XP_007018097.1| Glutamate receptor 3.3 isoform 4 [Theobroma ... 57 5e-06 ref|XP_007018096.1| Glutamate receptor 3.3 isoform 3 [Theobroma ... 57 5e-06 ref|XP_007018094.1| Glutamate receptor 3.3 isoform 1 [Theobroma ... 57 5e-06 ref|XP_002510703.1| glutamate receptor 3 plant, putative [Ricinu... 57 7e-06 >ref|XP_007018099.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao] gi|508723427|gb|EOY15324.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao] Length = 870 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = -2 Query: 317 LQTLLSLMDEKENHSKRENKRRKLDILSPDNDNESEFGRSPKRKAQISTDSKLNSSH 147 LQ LSLMDEKE+ SK KRRK++ DND + E GR PKR+ T S +NS + Sbjct: 814 LQRFLSLMDEKEDQSKSGQKRRKIEKSLSDNDRDDELGRKPKRRETEMTRSDVNSGN 870 >ref|XP_007018097.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao] gi|590595587|ref|XP_007018098.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao] gi|508723425|gb|EOY15322.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao] gi|508723426|gb|EOY15323.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao] Length = 843 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = -2 Query: 317 LQTLLSLMDEKENHSKRENKRRKLDILSPDNDNESEFGRSPKRKAQISTDSKLNSSH 147 LQ LSLMDEKE+ SK KRRK++ DND + E GR PKR+ T S +NS + Sbjct: 787 LQRFLSLMDEKEDQSKSGQKRRKIEKSLSDNDRDDELGRKPKRRETEMTRSDVNSGN 843 >ref|XP_007018096.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao] gi|508723424|gb|EOY15321.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao] Length = 941 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = -2 Query: 317 LQTLLSLMDEKENHSKRENKRRKLDILSPDNDNESEFGRSPKRKAQISTDSKLNSSH 147 LQ LSLMDEKE+ SK KRRK++ DND + E GR PKR+ T S +NS + Sbjct: 885 LQRFLSLMDEKEDQSKSGQKRRKIEKSLSDNDRDDELGRKPKRRETEMTRSDVNSGN 941 >ref|XP_007018094.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao] gi|590595576|ref|XP_007018095.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao] gi|508723422|gb|EOY15319.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao] gi|508723423|gb|EOY15320.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao] Length = 933 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = -2 Query: 317 LQTLLSLMDEKENHSKRENKRRKLDILSPDNDNESEFGRSPKRKAQISTDSKLNSSH 147 LQ LSLMDEKE+ SK KRRK++ DND + E GR PKR+ T S +NS + Sbjct: 877 LQRFLSLMDEKEDQSKSGQKRRKIEKSLSDNDRDDELGRKPKRRETEMTRSDVNSGN 933 >ref|XP_002510703.1| glutamate receptor 3 plant, putative [Ricinus communis] gi|223551404|gb|EEF52890.1| glutamate receptor 3 plant, putative [Ricinus communis] Length = 927 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -2 Query: 320 RLQTLLSLMDEKENHSKRENKRRKLDILSPDNDNESEFGRSPKRKAQIS 174 RL LLSLMDEKE+ SK +NKRRKL++ +ND ++E GR+ K+K I+ Sbjct: 877 RLHRLLSLMDEKEDPSKSKNKRRKLEMSLSENDRDAELGRNSKKKVTIA 925