BLASTX nr result
ID: Cornus23_contig00033602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00033602 (270 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP06433.1| unnamed protein product [Coffea canephora] 57 4e-06 >emb|CDP06433.1| unnamed protein product [Coffea canephora] Length = 384 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +3 Query: 27 LQAIEKHARH*TDADILVFDSYAWWIKPKMNVL 125 ++AIEKHARH TDADILVFDS+ WW++P+M +L Sbjct: 204 IEAIEKHARHWTDADILVFDSFMWWLQPEMTLL 236