BLASTX nr result
ID: Cornus23_contig00033583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00033583 (439 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283615.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 129 7e-28 emb|CAN83698.1| hypothetical protein VITISV_027543 [Vitis vinifera] 129 7e-28 ref|XP_008461661.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 125 1e-26 ref|XP_002530857.1| Dolichyl-phosphate beta-glucosyltransferase,... 125 2e-26 ref|XP_006435986.1| hypothetical protein CICLE_v10032053mg [Citr... 124 2e-26 gb|KNA18514.1| hypothetical protein SOVF_069880 [Spinacia oleracea] 124 4e-26 ref|XP_007009343.1| Nucleotide-diphospho-sugar transferases supe... 123 5e-26 ref|XP_008233622.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 123 6e-26 ref|XP_007218274.1| hypothetical protein PRUPE_ppa008313mg [Prun... 123 6e-26 ref|XP_004147693.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 123 6e-26 gb|KHN13909.1| Dolichyl-phosphate beta-glucosyltransferase [Glyc... 122 8e-26 ref|XP_009357723.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 122 8e-26 ref|XP_008382816.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 122 8e-26 ref|XP_003552702.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 122 8e-26 ref|XP_011091471.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 121 2e-25 gb|KHG30794.1| Dolichyl-phosphate beta-glucosyltransferase [Goss... 121 2e-25 gb|KJB60685.1| hypothetical protein B456_009G319400 [Gossypium r... 120 3e-25 ref|XP_012447983.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 120 3e-25 gb|KJB73916.1| hypothetical protein B456_011G260700 [Gossypium r... 120 4e-25 ref|XP_012454520.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 120 4e-25 >ref|XP_002283615.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Vitis vinifera] gi|731413053|ref|XP_010658582.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Vitis vinifera] gi|296086237|emb|CBI31678.3| unnamed protein product [Vitis vinifera] Length = 336 Score = 129 bits (325), Expect = 7e-28 Identities = 57/62 (91%), Positives = 60/62 (96%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELVYLCKWF IP+IEISVNWSEIPGSKVNPLSIPNMLWE+ALMS GYRTGMW+I Sbjct: 275 RWCFDVELVYLCKWFGIPMIEISVNWSEIPGSKVNPLSIPNMLWELALMSAGYRTGMWKI 334 Query: 258 ST 253 ST Sbjct: 335 ST 336 >emb|CAN83698.1| hypothetical protein VITISV_027543 [Vitis vinifera] Length = 251 Score = 129 bits (325), Expect = 7e-28 Identities = 57/62 (91%), Positives = 60/62 (96%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELVYLCKWF IP+IEISVNWSEIPGSKVNPLSIPNMLWE+ALMS GYRTGMW+I Sbjct: 190 RWCFDVELVYLCKWFGIPMIEISVNWSEIPGSKVNPLSIPNMLWELALMSAGYRTGMWKI 249 Query: 258 ST 253 ST Sbjct: 250 ST 251 >ref|XP_008461661.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Cucumis melo] Length = 328 Score = 125 bits (315), Expect = 1e-26 Identities = 54/62 (87%), Positives = 60/62 (96%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVE+VYLCK FHIP++EISVNWSEIPGSKVNPLSIPNMLWE+ALMS+GYRTGMWR+ Sbjct: 267 RWCFDVEIVYLCKRFHIPMVEISVNWSEIPGSKVNPLSIPNMLWELALMSMGYRTGMWRL 326 Query: 258 ST 253 T Sbjct: 327 HT 328 >ref|XP_002530857.1| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis] gi|223529581|gb|EEF31531.1| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis] Length = 335 Score = 125 bits (313), Expect = 2e-26 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVE+VYLCKWF IP+IEISVNWSEIPGSKVNPLSIPNMLWE+A+MS+GYRTGMW I Sbjct: 274 RWCFDVEVVYLCKWFSIPMIEISVNWSEIPGSKVNPLSIPNMLWELAIMSIGYRTGMWEI 333 >ref|XP_006435986.1| hypothetical protein CICLE_v10032053mg [Citrus clementina] gi|568865484|ref|XP_006486104.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Citrus sinensis] gi|557538182|gb|ESR49226.1| hypothetical protein CICLE_v10032053mg [Citrus clementina] gi|641848742|gb|KDO67618.1| hypothetical protein CISIN_1g019818mg [Citrus sinensis] Length = 335 Score = 124 bits (312), Expect = 2e-26 Identities = 56/62 (90%), Positives = 59/62 (95%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELVYLCK F IPIIEISVNWSEIPGSKVNPLSIPNMLWE+ALMSVGYRTGMW++ Sbjct: 274 RWCFDVELVYLCKRFGIPIIEISVNWSEIPGSKVNPLSIPNMLWELALMSVGYRTGMWKV 333 Query: 258 ST 253 T Sbjct: 334 RT 335 >gb|KNA18514.1| hypothetical protein SOVF_069880 [Spinacia oleracea] Length = 335 Score = 124 bits (310), Expect = 4e-26 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELVYLCKWF IP++EISV WSEIPGSKVN LSIPNMLWE+ALMSVGYRTGMWRI Sbjct: 274 RWCFDVELVYLCKWFRIPMVEISVTWSEIPGSKVNMLSIPNMLWELALMSVGYRTGMWRI 333 Query: 258 S 256 + Sbjct: 334 A 334 >ref|XP_007009343.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma cacao] gi|508726256|gb|EOY18153.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma cacao] Length = 335 Score = 123 bits (309), Expect = 5e-26 Identities = 53/62 (85%), Positives = 60/62 (96%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELV+LCKWF IP++EISVNWSEIPGSKVNPLSIPNMLWE+ALMSVGYRT MW+I Sbjct: 274 RWCFDVELVFLCKWFSIPMLEISVNWSEIPGSKVNPLSIPNMLWELALMSVGYRTRMWKI 333 Query: 258 ST 253 ++ Sbjct: 334 NS 335 >ref|XP_008233622.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Prunus mume] Length = 337 Score = 123 bits (308), Expect = 6e-26 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELVYLCKWF I +IEISVNWSEIPGSKVNPLSIPNMLWE+ LMSVGYRTGMW+I Sbjct: 276 RWCFDVELVYLCKWFRIRMIEISVNWSEIPGSKVNPLSIPNMLWELVLMSVGYRTGMWQI 335 >ref|XP_007218274.1| hypothetical protein PRUPE_ppa008313mg [Prunus persica] gi|462414736|gb|EMJ19473.1| hypothetical protein PRUPE_ppa008313mg [Prunus persica] Length = 337 Score = 123 bits (308), Expect = 6e-26 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELVYLCKWF I +IEISVNWSEIPGSKVNPLSIPNMLWE+ LMSVGYRTGMW+I Sbjct: 276 RWCFDVELVYLCKWFRIRMIEISVNWSEIPGSKVNPLSIPNMLWELVLMSVGYRTGMWQI 335 >ref|XP_004147693.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Cucumis sativus] Length = 328 Score = 123 bits (308), Expect = 6e-26 Identities = 54/62 (87%), Positives = 59/62 (95%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVE+VYL K FHIPI+EISVNWSEIPGSKVNPLSIPNMLWE+ALMS+GYRTGMWR+ Sbjct: 267 RWCFDVEIVYLSKRFHIPIVEISVNWSEIPGSKVNPLSIPNMLWELALMSMGYRTGMWRL 326 Query: 258 ST 253 T Sbjct: 327 HT 328 >gb|KHN13909.1| Dolichyl-phosphate beta-glucosyltransferase [Glycine soja] Length = 305 Score = 122 bits (307), Expect = 8e-26 Identities = 54/61 (88%), Positives = 57/61 (93%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELV+LCKWF IP+ EISVNWSEIPGSKVN LSIPNMLWE+ LMSVGYRTGMWRI Sbjct: 242 RWCFDVELVFLCKWFRIPVSEISVNWSEIPGSKVNLLSIPNMLWELVLMSVGYRTGMWRI 301 Query: 258 S 256 S Sbjct: 302 S 302 >ref|XP_009357723.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Pyrus x bretschneideri] Length = 336 Score = 122 bits (307), Expect = 8e-26 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVE+VYLCKWF IP++EISV+WSEIPGSKVNPLSIPNMLWE+ LMSVGYRTGMW+I Sbjct: 275 RWCFDVEVVYLCKWFKIPMLEISVSWSEIPGSKVNPLSIPNMLWELVLMSVGYRTGMWKI 334 >ref|XP_008382816.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Malus domestica] Length = 336 Score = 122 bits (307), Expect = 8e-26 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVE+VYLCKWF IP++EISV+WSEIPGSKVNPLSIPNMLWE+ LMSVGYRTGMW+I Sbjct: 275 RWCFDVEVVYLCKWFKIPMLEISVSWSEIPGSKVNPLSIPNMLWELVLMSVGYRTGMWKI 334 >ref|XP_003552702.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Glycine max] gi|947052133|gb|KRH01662.1| hypothetical protein GLYMA_18G291100 [Glycine max] Length = 333 Score = 122 bits (307), Expect = 8e-26 Identities = 54/61 (88%), Positives = 57/61 (93%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELV+LCKWF IP+ EISVNWSEIPGSKVN LSIPNMLWE+ LMSVGYRTGMWRI Sbjct: 270 RWCFDVELVFLCKWFRIPVSEISVNWSEIPGSKVNLLSIPNMLWELVLMSVGYRTGMWRI 329 Query: 258 S 256 S Sbjct: 330 S 330 >ref|XP_011091471.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Sesamum indicum] Length = 333 Score = 121 bits (304), Expect = 2e-25 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELVYLCK FHIP+IEISVNWSEIPGSKVN LSIPNMLWE+ALMS+GYRTGMW+I Sbjct: 272 RWCFDVELVYLCKLFHIPMIEISVNWSEIPGSKVNLLSIPNMLWELALMSLGYRTGMWKI 331 >gb|KHG30794.1| Dolichyl-phosphate beta-glucosyltransferase [Gossypium arboreum] Length = 331 Score = 121 bits (303), Expect = 2e-25 Identities = 51/62 (82%), Positives = 59/62 (95%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELV+LCKWFHIP++E+SVNW EIPGSKVN LSIPNMLWE+ALMSVGYRT MW+I Sbjct: 270 RWCFDVELVFLCKWFHIPVLEVSVNWFEIPGSKVNLLSIPNMLWELALMSVGYRTQMWKI 329 Query: 258 ST 253 ++ Sbjct: 330 NS 331 >gb|KJB60685.1| hypothetical protein B456_009G319400 [Gossypium raimondii] Length = 325 Score = 120 bits (302), Expect = 3e-25 Identities = 51/62 (82%), Positives = 60/62 (96%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVE+V+LCKWF IP++EISVNWSEIPGSKVNPLSIPNMLWE+ALMSVGYRT +W+I Sbjct: 264 RWCFDVEIVFLCKWFGIPMLEISVNWSEIPGSKVNPLSIPNMLWELALMSVGYRTRIWKI 323 Query: 258 ST 253 ++ Sbjct: 324 NS 325 >ref|XP_012447983.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Gossypium raimondii] gi|763793686|gb|KJB60682.1| hypothetical protein B456_009G319400 [Gossypium raimondii] Length = 335 Score = 120 bits (302), Expect = 3e-25 Identities = 51/62 (82%), Positives = 60/62 (96%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVE+V+LCKWF IP++EISVNWSEIPGSKVNPLSIPNMLWE+ALMSVGYRT +W+I Sbjct: 274 RWCFDVEIVFLCKWFGIPMLEISVNWSEIPGSKVNPLSIPNMLWELALMSVGYRTRIWKI 333 Query: 258 ST 253 ++ Sbjct: 334 NS 335 >gb|KJB73916.1| hypothetical protein B456_011G260700 [Gossypium raimondii] Length = 246 Score = 120 bits (301), Expect = 4e-25 Identities = 51/62 (82%), Positives = 59/62 (95%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELV+LCKWF IP++E+SVNWSEIPGSKVN LSIPNMLWE+ALMSVGYRT MW+I Sbjct: 185 RWCFDVELVFLCKWFRIPVLEVSVNWSEIPGSKVNLLSIPNMLWELALMSVGYRTQMWKI 244 Query: 258 ST 253 ++ Sbjct: 245 NS 246 >ref|XP_012454520.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Gossypium raimondii] gi|763806977|gb|KJB73915.1| hypothetical protein B456_011G260700 [Gossypium raimondii] Length = 333 Score = 120 bits (301), Expect = 4e-25 Identities = 51/62 (82%), Positives = 59/62 (95%) Frame = -2 Query: 438 RWCFDVELVYLCKWFHIPIIEISVNWSEIPGSKVNPLSIPNMLWEMALMSVGYRTGMWRI 259 RWCFDVELV+LCKWF IP++E+SVNWSEIPGSKVN LSIPNMLWE+ALMSVGYRT MW+I Sbjct: 272 RWCFDVELVFLCKWFRIPVLEVSVNWSEIPGSKVNLLSIPNMLWELALMSVGYRTQMWKI 331 Query: 258 ST 253 ++ Sbjct: 332 NS 333