BLASTX nr result
ID: Cornus23_contig00033457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00033457 (300 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001791660.1| hypothetical protein SNOG_00999 [Parastagono... 67 5e-09 ref|XP_003838247.1| hypothetical protein LEMA_P117710.1 [Leptosp... 66 1e-08 gb|KNG46248.1| ubiquinone biosynthesis methyltransferase [Stemph... 62 2e-07 >ref|XP_001791660.1| hypothetical protein SNOG_00999 [Parastagonospora nodorum SN15] gi|160701316|gb|EAT92494.2| hypothetical protein SNOG_00999 [Parastagonospora nodorum SN15] Length = 37 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 229 MQSTNVLVNFHNDACPRCGAGINGGSKTCGSCGSACPV 116 MQST VLVNFHND CP+CGA I+ +KTCGSCGS+CPV Sbjct: 1 MQSTTVLVNFHND-CPKCGASISDATKTCGSCGSSCPV 37 >ref|XP_003838247.1| hypothetical protein LEMA_P117710.1 [Leptosphaeria maculans JN3] gi|312214814|emb|CBX94768.1| hypothetical protein LEMA_P117710.1 [Leptosphaeria maculans JN3] Length = 37 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 229 MQSTNVLVNFHNDACPRCGAGINGGSKTCGSCGSACPV 116 MQST VLV++HN +CP+CGAGI+G SK CGSCGS+CPV Sbjct: 1 MQSTTVLVDYHN-SCPKCGAGISGDSKNCGSCGSSCPV 37 >gb|KNG46248.1| ubiquinone biosynthesis methyltransferase [Stemphylium lycopersici] Length = 337 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 229 MQSTNVLVNFHNDACPRCGAGINGGSKTCGSCGS 128 MQST +LV+ HND+CP+CGAGI+ G+K+CGSCGS Sbjct: 287 MQSTTILVHSHNDSCPKCGAGISDGTKSCGSCGS 320