BLASTX nr result
ID: Cornus23_contig00033295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00033295 (397 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CEP01949.1| hypothetical protein PBRA_002214 [Plasmodiophora... 62 1e-07 >emb|CEP01949.1| hypothetical protein PBRA_002214 [Plasmodiophora brassicae] Length = 431 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/56 (50%), Positives = 38/56 (67%) Frame = -2 Query: 381 NLYKDIRQPFDQRFFFILNLAIGGGFFGAQANALTPATARNWPVPEMVVDYVRVYQ 214 ++YK PFD+ F+ I+NLA+GG FFG A+ LT TA W P + VDYVRV++ Sbjct: 298 DIYKKNGAPFDEEFYLIMNLAVGGEFFGPDADKLTTKTALAWQRPFLEVDYVRVFE 353