BLASTX nr result
ID: Cornus23_contig00033102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00033102 (355 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318358.2| hypothetical protein POPTR_0012s01130g [Popu... 57 7e-06 >ref|XP_002318358.2| hypothetical protein POPTR_0012s01130g [Populus trichocarpa] gi|550326121|gb|EEE96578.2| hypothetical protein POPTR_0012s01130g [Populus trichocarpa] Length = 475 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 353 EGGRIFREKVREMRGLFGDRNTQDKYVDNLLAHFQSHR 240 E G+++R+K +EM GLFGDR+ QDKYVDN+L + +SHR Sbjct: 428 EEGKMYRDKAKEMSGLFGDRDRQDKYVDNILIYLKSHR 465