BLASTX nr result
ID: Cornus23_contig00032192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00032192 (281 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN80245.1| hypothetical protein VITISV_031023 [Vitis vinifera] 54 9e-06 >emb|CAN80245.1| hypothetical protein VITISV_031023 [Vitis vinifera] Length = 1636 Score = 53.5 bits (127), Expect(2) = 9e-06 Identities = 19/43 (44%), Positives = 31/43 (72%) Frame = -3 Query: 279 AWRATPLCIWWGLWQKRNRRSFDGEETPIWSLKYKILCSLFFF 151 AW+ PLCI+W +W++RNR +F E+ + LKY +C+L+F+ Sbjct: 1573 AWQMAPLCIFWSVWKERNRLAFGDEDLSLQRLKYSFVCNLWFW 1615 Score = 22.3 bits (46), Expect(2) = 9e-06 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 160 IFFWMNGRNCKSMDHLLDFVD 98 ++FW+ G +S L+ FVD Sbjct: 1612 LWFWVRGSLAESHSSLVSFVD 1632