BLASTX nr result
ID: Cornus23_contig00032104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00032104 (328 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010093466.1| putative leucine-rich repeat receptor-like s... 58 3e-06 ref|XP_010093467.1| hypothetical protein L484_017528 [Morus nota... 57 5e-06 >ref|XP_010093466.1| putative leucine-rich repeat receptor-like serine/threonine-protein kinase [Morus notabilis] gi|587864436|gb|EXB54090.1| putative leucine-rich repeat receptor-like serine/threonine-protein kinase [Morus notabilis] Length = 405 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 233 NGMKPFGVKSKSKTVRAQAQSGQYHTMWWRGLLQFASK 120 NGM+PFGV+ KSKTVR QAQSGQYHT W G L S+ Sbjct: 6 NGMRPFGVRPKSKTVRTQAQSGQYHTRWGCGSLHIVSE 43 >ref|XP_010093467.1| hypothetical protein L484_017528 [Morus notabilis] gi|587864437|gb|EXB54091.1| hypothetical protein L484_017528 [Morus notabilis] Length = 772 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/66 (50%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Frame = -2 Query: 324 CERYWANY-RLYNPILLGCE-REWTIYVGSISKWYEAFWGKIQEQNRASSGPKRTISYHV 151 C W N RL +P G E R W I + +W+E+FWG+ Q+QNRA SGPKRTISY V Sbjct: 687 CTPTWYNIVRLTSP---GDEDRSWFIRNDTTYQWFESFWGETQKQNRAGSGPKRTISYQV 743 Query: 150 VEGAVT 133 VT Sbjct: 744 GVWVVT 749