BLASTX nr result
ID: Cornus23_contig00031939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00031939 (264 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME40166.1| hypothetical protein DOTSEDRAFT_74855 [Dothistrom... 58 2e-06 >gb|EME40166.1| hypothetical protein DOTSEDRAFT_74855 [Dothistroma septosporum NZE10] Length = 639 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/49 (57%), Positives = 38/49 (77%) Frame = -3 Query: 262 HTVVEPRTVGQAPKETPLYHEDDGEAKPGMMEQAQTLAGQAVESVQGIP 116 H+V+EPRTVGQAPK+TP+ E+ E +P ++EQAQ AGQAVE+ + P Sbjct: 532 HSVMEPRTVGQAPKDTPIMREE--EPQPTIIEQAQEYAGQAVEAAKHAP 578