BLASTX nr result
ID: Cornus23_contig00031636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00031636 (428 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09782.1| hypothetical protein B456_001G165500 [Gossypium r... 85 2e-14 ref|XP_002535797.1| conserved hypothetical protein [Ricinus comm... 60 2e-10 ref|XP_002522075.1| conserved hypothetical protein [Ricinus comm... 48 1e-07 ref|XP_002535796.1| conserved hypothetical protein [Ricinus comm... 44 5e-07 >gb|KJB09782.1| hypothetical protein B456_001G165500 [Gossypium raimondii] Length = 732 Score = 85.1 bits (209), Expect = 2e-14 Identities = 62/140 (44%), Positives = 69/140 (49%), Gaps = 3/140 (2%) Frame = +1 Query: 13 SNRFRAPLYLKEMVLDERIQISHYAVGWGESCSAKLGVQCSYGGTIDEIE*KGPSKKSEG 192 S R R P YLK MVLDE IQI HYAVGWG SCSAKLGV Sbjct: 201 SLRVRTPFYLKGMVLDETIQIPHYAVGWGGSCSAKLGVH--------------------- 239 Query: 193 VMKCS*AAKYQSRN---SIGAKGSVLHLLIVRESNSLSCHAFHSLA*VVLNHSFCLAFVL 363 + + +Y + S+ + V L+ R LS F S FVL Sbjct: 240 -RQVPVSQQYWRKRIGPSLADRSRVELALLPR----LSLTRFRS-------------FVL 281 Query: 364 HSLAITRRERSNQGAYYHIE 423 HSLAITRRERSNQGAYYHIE Sbjct: 282 HSLAITRRERSNQGAYYHIE 301 >ref|XP_002535797.1| conserved hypothetical protein [Ricinus communis] gi|223521923|gb|EEF26586.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 60.1 bits (144), Expect(2) = 2e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 201 MLVSRQVPVSQQYWRKRIGPSLADRSRVE 287 +LVSRQVPVSQQYWRKRIGPSLADRSRVE Sbjct: 2 LLVSRQVPVSQQYWRKRIGPSLADRSRVE 30 Score = 32.0 bits (71), Expect(2) = 2e-10 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +2 Query: 338 TLFVWHSFFTL-LLLPAGSAATKVHIII 418 +LF++ F L L PAGSAATKVHIII Sbjct: 47 SLFLFGGSFVLHSLAPAGSAATKVHIII 74 >ref|XP_002522075.1| conserved hypothetical protein [Ricinus communis] gi|223538674|gb|EEF40275.1| conserved hypothetical protein [Ricinus communis] Length = 207 Score = 47.8 bits (112), Expect(2) = 1e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 213 RQVPVSQQYWRKRIGPSLADRSRVE 287 RQVPVSQQYW KRI PSL DRSRVE Sbjct: 38 RQVPVSQQYWCKRISPSLVDRSRVE 62 Score = 34.7 bits (78), Expect(2) = 1e-07 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +1 Query: 49 MVLDERIQISHYAVGWGES 105 MVLDE IQI HY VGWG + Sbjct: 1 MVLDETIQIPHYVVGWGSA 19 >ref|XP_002535796.1| conserved hypothetical protein [Ricinus communis] gi|223521922|gb|EEF26585.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 44.3 bits (103), Expect(2) = 5e-07 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = +3 Query: 126 SVFLWRNHRRNRIERAFKKERGSD 197 SVFLWRNH R +IE+AFKKER SD Sbjct: 36 SVFLWRNHTRKKIEKAFKKERESD 59 Score = 36.2 bits (82), Expect(2) = 5e-07 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 49 MVLDERIQISHYAVGWGES 105 MVLDE IQI HYAVGWG + Sbjct: 1 MVLDETIQIPHYAVGWGSA 19