BLASTX nr result
ID: Cornus23_contig00030378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00030378 (305 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038597.1| Retrotransposon, unclassified-like protein [... 63 8e-08 ref|XP_007032383.1| H0502G05.11 protein [Theobroma cacao] gi|508... 63 8e-08 ref|XP_007044604.1| H0502G05.11 protein [Theobroma cacao] gi|508... 61 3e-07 >ref|XP_007038597.1| Retrotransposon, unclassified-like protein [Theobroma cacao] gi|508775842|gb|EOY23098.1| Retrotransposon, unclassified-like protein [Theobroma cacao] Length = 1609 Score = 63.2 bits (152), Expect = 8e-08 Identities = 24/57 (42%), Positives = 38/57 (66%) Frame = +1 Query: 10 PTAEDERSPKFCLYHRHTRHPTYDCWALRNIFQKRIMRGELILGNQDVRADPFPNHP 180 PT E++ +P++C YHR HP +C LR +F +R+ GE+++GN V+ +P P HP Sbjct: 407 PTTEEKANPRYCDYHRTVGHPLAECRNLRRMFHRRVQAGEVLIGNNRVQNNPLPIHP 463 >ref|XP_007032383.1| H0502G05.11 protein [Theobroma cacao] gi|508711412|gb|EOY03309.1| H0502G05.11 protein [Theobroma cacao] Length = 1352 Score = 63.2 bits (152), Expect = 8e-08 Identities = 24/57 (42%), Positives = 39/57 (68%) Frame = +1 Query: 10 PTAEDERSPKFCLYHRHTRHPTYDCWALRNIFQKRIMRGELILGNQDVRADPFPNHP 180 PTA+++ +P++C YHR HP +C LR +F +R+ GE+++GN V+ +P P HP Sbjct: 372 PTAKEKANPRYCDYHRTVGHPLAECRNLRRMFHRRVQAGEVLIGNNRVQNNPLPIHP 428 >ref|XP_007044604.1| H0502G05.11 protein [Theobroma cacao] gi|508708539|gb|EOY00436.1| H0502G05.11 protein [Theobroma cacao] Length = 537 Score = 61.2 bits (147), Expect = 3e-07 Identities = 23/57 (40%), Positives = 38/57 (66%) Frame = +1 Query: 10 PTAEDERSPKFCLYHRHTRHPTYDCWALRNIFQKRIMRGELILGNQDVRADPFPNHP 180 PT E++ +P++C YHR HP +C LR +F +++ GE+++GN V+ +P P HP Sbjct: 407 PTTEEKANPRYCDYHRTVGHPLAECRNLRRMFHQQVQAGEVLIGNNRVQNNPLPIHP 463